DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG1773 and AgaP_AGAP012817

DIOPT Version :9

Sequence 1:NP_610512.1 Gene:CG1773 / 35999 FlyBaseID:FBgn0033439 Length:317 Species:Drosophila melanogaster
Sequence 2:XP_560999.5 Gene:AgaP_AGAP012817 / 3292527 VectorBaseID:AGAP012817 Length:439 Species:Anopheles gambiae


Alignment Length:291 Identity:76/291 - (26%)
Similarity:116/291 - (39%) Gaps:66/291 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    46 CGVLSNLIPAQRLRRRITGGRKSSLLSQPWMAFLHISGDIEMCRCGGSLLSELFVLTAAHCFKMC 110
            ||..|..:        :..|:.:.|   ||:.|  :....|..:|..:|:||.:|:..|.||:  
Mosquito   180 CGTKSETV--------LDNGQPAPL---PWLGF--VLTKEEKVKCVVTLISEWYVVGTASCFE-- 229

  Fly   111 PRSKEIRVWLGELDISSTSDCVTYNYQRVCALPVEEFTIDKWILHEEFNLFYPGYDIALIKLNKK 175
            ...|::|:..|..:......|...|...|||.|.:..:|.:.:.|..|:......:||||:|...
Mosquito   230 KNEKDLRILFGGYEDLLEQKCFERNGSTVCAYPTQSRSIGRVVAHPRFSKNTINDNIALIELQSP 294

  Fly   176 V-VFKDHIRPICLPLTDEL----------LAFTLQLG----QSYMAVGWGRTESRRFANSTMEVH 225
            . ..:.|::|||||:|..|          |||.|..|    ||...|      ...|..|   ||
Mosquito   295 ADTTQPHVKPICLPVTPTLYTNRTENFSVLAFRLTTGTIVDQSVNHV------DPDFCKS---VH 350

  Fly   226 INTEKCTDGRDTSFLCANGDYVDTCTGDSGGPLIWKTTLFGKARTVQ--FGVVSTGSQ------- 281
            |......|..:.|| |.:....|....||         |.|:...:|  ..:|:.|.:       
Mosquito   351 IVAGFAIDNEEKSF-CVSVPEEDVANCDS---------LLGQGTPLQEHVSMVNAGERYVLRGFD 405

  Fly   282 ----NCGAGQKA---YYMDVPTYVPWILAKM 305
                .| ||..:   .|::|.:|:.|:|..|
Mosquito   406 LLGLTC-AGDSSIPVLYVNVYSYLDWMLYNM 435

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG1773NP_610512.1 Tryp_SPc 61..301 CDD:214473 70/270 (26%)
Tryp_SPc 62..301 CDD:238113 70/269 (26%)
AgaP_AGAP012817XP_560999.5 Tryp_SPc <1..150 CDD:238113
Tryp_SPc 190..430 CDD:214473 70/266 (26%)
Tryp_SPc 190..430 CDD:304450 70/266 (26%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.