DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG1773 and AgaP_AGAP011909

DIOPT Version :9

Sequence 1:NP_610512.1 Gene:CG1773 / 35999 FlyBaseID:FBgn0033439 Length:317 Species:Drosophila melanogaster
Sequence 2:XP_320620.4 Gene:AgaP_AGAP011909 / 3291449 VectorBaseID:AGAP011909 Length:400 Species:Anopheles gambiae


Alignment Length:321 Identity:80/321 - (24%)
Similarity:132/321 - (41%) Gaps:65/321 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 GITALIWGILCLSCPPSSQAGREDWTPHELLAYEQLTQQDCGVLSNLIPAQRLRRRITGGRKSSL 70
            |:|      :.|..|.:|:.||...|..::       :..||:        |..|:|.||.::.:
Mosquito   120 GLT------IALLVPGTSKGGRFFCTATKI-------ECQCGM--------RRTRKIVGGEETLV 163

  Fly    71 LSQPWMAFLHISGDI--EMCRCGGSLLSELFVLTAAHCFKMCPRSKEIRVWLGELDISSTSDCVT 133
            ...|.||.| :.|..  |...||.::::....:|||||: |......:.:.:||.||::.|:...
Mosquito   164 NEFPMMAAL-VDGSKSGEGIFCGATIITNYHAVTAAHCY-MGRSIANLALLVGEHDITTGSESPY 226

  Fly   134 YNYQRVCALPVEEFTIDKWILHEEFNLFYPGY---------DIALIKLNKKVVFKDHIRPICLPL 189
            .....:.::.:.|                 ||         |||:::...:::|...:.|.|||:
Mosquito   227 TALLLLASIKIHE-----------------GYSSTTSSSSNDIAIVRTRTEILFNAGVGPACLPI 274

  Fly   190 TDELLAFTLQLGQSYMAVGWGRTE-SRRFANSTMEVH---INTEKCTDGRDT----SFLCANGDY 246
            .....:|   :|....|||||..: ....:|..|:|.   :|..:|:....|    ..||.....
Mosquito   275 KFVGASF---VGIQLEAVGWGTLDYGAPKSNVPMKVALPVVNPSQCSALYPTFSAQQQLCTLTPN 336

  Fly   247 VDTCTGDSGGPLIWKTTLFGKARTVQFGVVSTGSQNCGAGQKAYYMDVPTYVPWILAKMAE 307
            .|||..||||||.: |..:.| |....|.:..|.. |...:.:...:|..|..||:....|
Mosquito   337 KDTCQSDSGGPLFY-TDAYNK-RAYLLGTIGYGIA-CATDRPSVSTNVLYYTQWIMNNTPE 394

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG1773NP_610512.1 Tryp_SPc 61..301 CDD:214473 65/258 (25%)
Tryp_SPc 62..301 CDD:238113 65/257 (25%)
AgaP_AGAP011909XP_320620.4 CUB 52..123 CDD:294042 2/8 (25%)
Tryp_SPc 154..388 CDD:214473 65/258 (25%)
Tryp_SPc 155..391 CDD:238113 67/260 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.