DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG1773 and AgaP_AGAP007141

DIOPT Version :9

Sequence 1:NP_610512.1 Gene:CG1773 / 35999 FlyBaseID:FBgn0033439 Length:317 Species:Drosophila melanogaster
Sequence 2:XP_565054.3 Gene:AgaP_AGAP007141 / 3290313 VectorBaseID:AGAP007141 Length:254 Species:Anopheles gambiae


Alignment Length:262 Identity:64/262 - (24%)
Similarity:108/262 - (41%) Gaps:56/262 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    61 RITGGRKSSLLSQPWMAFLH-ISGDIEMCRCGGSLLSELFVLTAAHCFKMCPRSKEIRVWLGELD 124
            |:.||..:...:.|:...|. :.|.    .|||:::...::||||||.:...:..::.|....|:
Mosquito    30 RVVGGTDAPPGAAPYQVSLQGLFGH----SCGGAIIDRDWILTAAHCVQTSVKFTKVLVGTNLLN 90

  Fly   125 ISSTSDCVTYNYQRVCALPVEEFTIDKWILHEEFN--LFYPGYDIALIKLNKKVVFKDHIRPICL 187
            ...                 :.:.::|:.:|..:|  :|:  .||||:||...:.:.|.::||..
Mosquito    91 AGG-----------------QRYAVEKFYVHSRYNNPVFH--NDIALVKLKSMIQYDDLVQPIAY 136

  Fly   188 PLTDELLAFTLQLGQSYMAVGWGRTESRRFANSTME----VHINTEKC------TDGRDTSFLCA 242
            ...:.....||.|      .||||........:.::    .::..|:|      ::..|...:|.
Mosquito   137 SEREIPENATLTL------TGWGRLSGTGAMPNKLQTIDLTYVPYEECKRLHGNSENVDIGHVCT 195

  Fly   243 ---NGDYVDTCTGDSGGPLIWKTTLFGKARTVQFGVVSTGSQNCGAGQKAYYMDVPTYVPWILAK 304
               .|:  ..|.|||||||:::..|.|   .|.|||      .|..|....|..|..|..||...
Mosquito   196 LTKKGE--GACNGDSGGPLVYEGKLVG---VVNFGV------PCALGYPDAYARVSYYHDWIRTT 249

  Fly   305 MA 306
            :|
Mosquito   250 IA 251

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG1773NP_610512.1 Tryp_SPc 61..301 CDD:214473 61/255 (24%)
Tryp_SPc 62..301 CDD:238113 60/254 (24%)
AgaP_AGAP007141XP_565054.3 Tryp_SPc 30..246 CDD:214473 61/255 (24%)
Tryp_SPc 31..249 CDD:238113 62/257 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.