DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG1773 and gd

DIOPT Version :9

Sequence 1:NP_610512.1 Gene:CG1773 / 35999 FlyBaseID:FBgn0033439 Length:317 Species:Drosophila melanogaster
Sequence 2:NP_001259479.1 Gene:gd / 32159 FlyBaseID:FBgn0000808 Length:531 Species:Drosophila melanogaster


Alignment Length:295 Identity:75/295 - (25%)
Similarity:118/295 - (40%) Gaps:76/295 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    62 ITGGRKSSLLSQPWMAFLHISGDIEM-CRCGGSLLSELFVLTAAHCFKMCPR---SKEIRVWLGE 122
            ||.|      |.||:|.::::....: .:|||||:|...|:::|||||:..:   |.|:.|:||.
  Fly   257 ITRG------SWPWLAAIYVNNLTSLDFQCGGSLVSARVVISSAHCFKLFNKRYTSNEVLVFLGR 315

  Fly   123 LDISSTSDCVTYNYQRVCALPVEEFTIDKWILHEEFNLFYPGY--DIALIKLNKKVVFKDHIRPI 185
            .::.:      :|.:...|.||     |...:|.:||.....|  |||:|.|..:|.|...|||.
  Fly   316 HNLKN------WNEEGSLAAPV-----DGIYIHPDFNSQLSSYDADIAVIILKDEVRFNTFIRPA 369

  Fly   186 CL----PLTDELLAFTLQLGQSYMAVGWGRTESRRFANSTMEVHINTEKCTD------------G 234
            ||    ..|:.:      :|:..:.:||....:.|..:..:...:..:|.||            |
  Fly   370 CLWSGSSKTEYI------VGERGIVIGWSFDRTNRTRDQKLSSELPGKKSTDASAPKVVKAPIVG 428

  Fly   235 RDTSF--------------LCA--NGDYVDT-------CTGDSGGPLI------W--KTTLFGKA 268
            ....|              .||  ..:..||       .||.||..|.      |  :.|:....
  Fly   429 NAECFRANAHFRSLSSNRTFCAGIQAEERDTHQSGASIYTGISGAGLFIRRNNRWMLRGTVSAAL 493

  Fly   269 RTVQFGVVSTGSQNCGAGQKAYYMDVPTYVPWILA 303
            ..|:.....:..:.|...|...|.||..::.||.|
  Fly   494 PAVETPDAESSHKLCCKNQYIIYADVAKFLDWITA 528

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG1773NP_610512.1 Tryp_SPc 61..301 CDD:214473 72/291 (25%)
Tryp_SPc 62..301 CDD:238113 72/291 (25%)
gdNP_001259479.1 GD_N 27..124 CDD:292649
Tryp_SPc 257..526 CDD:238113 72/291 (25%)
Tryp_SPc 258..526 CDD:214473 71/290 (24%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45456144
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24258
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.