DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG1773 and Ser7

DIOPT Version :9

Sequence 1:NP_610512.1 Gene:CG1773 / 35999 FlyBaseID:FBgn0033439 Length:317 Species:Drosophila melanogaster
Sequence 2:NP_572582.1 Gene:Ser7 / 31917 FlyBaseID:FBgn0019929 Length:397 Species:Drosophila melanogaster


Alignment Length:294 Identity:93/294 - (31%)
Similarity:140/294 - (47%) Gaps:36/294 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    31 TPHELLAYEQLTQQD-CGVLSNLIPAQRLRRRITGGRKSSLLSQPWMAFLH---ISGDIEMCRCG 91
            ||......:||.:.. ||...:.        |:.||..:.|...||...|.   :||..:.. ||
  Fly   108 TPRPPSGIDQLPEHPYCGSAFSF--------RLVGGHNTGLFEFPWTTLLEYETVSGGKDYA-CG 163

  Fly    92 GSLLSELFVLTAAHCFKMCPRSKEIRVWLGELDISSTSDCVT-YNYQRVCALPVEEFTIDKWILH 155
            .|.:::.::||||||.....|:....: |||.:..:..||.. .|..|.||.|....|||:.:.|
  Fly   164 ASFIAQRWLLTAAHCIHTMGRNLTAAI-LGEWNRDTDPDCENDLNGVRECAPPHIRVTIDRILPH 227

  Fly   156 EEFNLFYPGYDIALIKLNKKV--VFKDHIRPICLPLTDELLAFTLQLGQSYMAV-GWGRTE---S 214
            .:::......||||::|::.|  :...::.|:|||  .:...:..||..|...| |||:||   |
  Fly   228 AQYSELNYRNDIALLRLSRPVNWLQMQNLEPVCLP--PQRGRYANQLAGSAADVSGWGKTESSGS 290

  Fly   215 RRFANSTMEVHIN-TEKCTDG--RDT------SFLCANGDY-VDTCTGDSGGPL-IWKTTLFGKA 268
            .:.....| :||. .::|.:.  :||      |.:||.|:. ||:|:||||||| :...|..|..
  Fly   291 SKIKQKAM-LHIQPQDQCQEAFYKDTKITLADSQMCAGGEIGVDSCSGDSGGPLTVEANTASGNR 354

  Fly   269 RTVQFGVVSTGSQNCGAGQ-KAYYMDVPTYVPWI 301
            .....||||.|.::||... ...|..|.:|:.||
  Fly   355 YVYLAGVVSIGRKHCGTALFSGIYTRVSSYMDWI 388

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG1773NP_610512.1 Tryp_SPc 61..301 CDD:214473 85/261 (33%)
Tryp_SPc 62..301 CDD:238113 84/260 (32%)
Ser7NP_572582.1 CLIP 29..74 CDD:197829
Tryp_SPc 131..388 CDD:214473 85/261 (33%)
Tryp_SPc 133..391 CDD:238113 86/261 (33%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45455943
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24258
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.