DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG1773 and CG32260

DIOPT Version :9

Sequence 1:NP_610512.1 Gene:CG1773 / 35999 FlyBaseID:FBgn0033439 Length:317 Species:Drosophila melanogaster
Sequence 2:NP_728942.1 Gene:CG32260 / 317943 FlyBaseID:FBgn0052260 Length:575 Species:Drosophila melanogaster


Alignment Length:316 Identity:92/316 - (29%)
Similarity:126/316 - (39%) Gaps:77/316 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    20 PPSSQAGREDWTPHELLAYEQLTQQDCGV---LSNLIPAQRLRRRITGGRKSSLLSQPWMAFLHI 81
            ||.:.|.||..|              ||:   .||         |:.||.::...:.||:|.|  
  Fly   306 PPPNNAPRESAT--------------CGISGATSN---------RVVGGMEARKGAYPWIAAL-- 345

  Fly    82 SGDIE-------MCRCGGSLLSELFVLTAAHCFKMCPRSKEIRVWLGELDISSTSDCVTYNYQRV 139
             |..|       ...|||||:...:|:|:|||..  |....:|  ||..|:|.            
  Fly   346 -GYFEENNRNALKFLCGGSLIHSRYVITSAHCIN--PMLTLVR--LGAHDLSQ------------ 393

  Fly   140 CALPVEEFTID----KWILHEEFNLFYPGYDIALIKLNKKVVFKDHIRPICLPLTDELLAFTLQ- 199
               |.|...:|    :.::||.|:|.....|||||:||.......:|.|||||   |...|..| 
  Fly   394 ---PAESGAMDLRIRRTVVHEHFDLNSISNDIALIELNVVGALPGNISPICLP---EAAKFMQQD 452

  Fly   200 -LGQSYMAVGWGRTESRRFANSTM---EVHI-NTEKCTDGRDTSF---------LCANGDYVDTC 250
             :|.:....|||..:.:...:..:   :|.| :...|.....:.|         |||....||.|
  Fly   453 FVGMNPFVAGWGAVKHQGVTSQVLRDAQVPIVSRHSCEQSYKSIFQFVQFSDKVLCAGSSSVDAC 517

  Fly   251 TGDSGGPLIWKTTLFGKARTVQFGVVSTGSQNCGAGQKAYYMDVPTYVPWILAKMA 306
            .|||||||:.........|....|:||.|.:.........|..|.:|||||...:|
  Fly   518 QGDSGGPLMMPQLEGNVYRFYLLGLVSFGYECARPNFPGVYTRVASYVPWIKKHIA 573

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG1773NP_610512.1 Tryp_SPc 61..301 CDD:214473 79/265 (30%)
Tryp_SPc 62..301 CDD:238113 78/264 (30%)
CG32260NP_728942.1 CLIP 194..244 CDD:288855
Tryp_SPc 327..568 CDD:214473 79/265 (30%)
Tryp_SPc 328..571 CDD:238113 80/267 (30%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45456134
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24258
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.