DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG1773 and CG1632

DIOPT Version :10

Sequence 1:NP_610512.1 Gene:CG1773 / 35999 FlyBaseID:FBgn0033439 Length:317 Species:Drosophila melanogaster
Sequence 2:NP_572467.1 Gene:CG1632 / 31763 FlyBaseID:FBgn0030027 Length:1056 Species:Drosophila melanogaster


Alignment Length:174 Identity:48/174 - (27%)
Similarity:77/174 - (44%) Gaps:38/174 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    32 PHELLAYEQLTQQDCGVLSNLIPAQRLRRRITGGRKSSLLSQPWMAFLHISGDIEMCRCGGSLLS 96
            |...:.|....:..|||.|.|..|   ::.::..:.|:....||:..| ...||.:  |.|:|::
  Fly   675 PRRQVLYVGCGELRCGVQSALFNA---KQHLSLPKMSAPGDWPWLVAL-FREDIHV--CDGTLIT 733

  Fly    97 ELFVLTAAHCFKMCPRSKEIRVWL---GELDISSTSDCVTYNYQRVCAL---PVEEFTIDKWILH 155
            :.:|||...||:..||:    .|:   |.:.:|:.:...  ..:|:..:   |||          
  Fly   734 QDWVLTTEGCFQGQPRA----TWMAIVGAVRLSAKAPWT--QRRRIIGMIKSPVE---------- 782

  Fly   156 EEFNLFYPGYDIALIKLNKKVVFKDHIRPICLPLTDELLAFTLQ 199
                    |...||::|...|.:.||:||||||  |.|....||
  Fly   783 --------GSTAALVRLETPVSYSDHVRPICLP--DALQRRLLQ 816

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG1773NP_610512.1 Tryp_SPc 61..301 CDD:214473 40/145 (28%)
CG1632NP_572467.1 SEA 232..>309 CDD:460188
CRD_FZ 384..502 CDD:143549
PRKCSH-like <503..>582 CDD:372423
LDLa 536..571 CDD:238060
Tryp_SPc 708..>809 CDD:473915 36/129 (28%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.