DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG1773 and CG1632

DIOPT Version :9

Sequence 1:NP_610512.1 Gene:CG1773 / 35999 FlyBaseID:FBgn0033439 Length:317 Species:Drosophila melanogaster
Sequence 2:NP_001245577.1 Gene:CG1632 / 31763 FlyBaseID:FBgn0030027 Length:1056 Species:Drosophila melanogaster


Alignment Length:174 Identity:48/174 - (27%)
Similarity:77/174 - (44%) Gaps:38/174 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    32 PHELLAYEQLTQQDCGVLSNLIPAQRLRRRITGGRKSSLLSQPWMAFLHISGDIEMCRCGGSLLS 96
            |...:.|....:..|||.|.|..|   ::.::..:.|:....||:..| ...||.:  |.|:|::
  Fly   675 PRRQVLYVGCGELRCGVQSALFNA---KQHLSLPKMSAPGDWPWLVAL-FREDIHV--CDGTLIT 733

  Fly    97 ELFVLTAAHCFKMCPRSKEIRVWL---GELDISSTSDCVTYNYQRVCAL---PVEEFTIDKWILH 155
            :.:|||...||:..||:    .|:   |.:.:|:.:...  ..:|:..:   |||          
  Fly   734 QDWVLTTEGCFQGQPRA----TWMAIVGAVRLSAKAPWT--QRRRIIGMIKSPVE---------- 782

  Fly   156 EEFNLFYPGYDIALIKLNKKVVFKDHIRPICLPLTDELLAFTLQ 199
                    |...||::|...|.:.||:||||||  |.|....||
  Fly   783 --------GSTAALVRLETPVSYSDHVRPICLP--DALQRRLLQ 816

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG1773NP_610512.1 Tryp_SPc 61..301 CDD:214473 40/145 (28%)
Tryp_SPc 62..301 CDD:238113 40/144 (28%)
CG1632NP_001245577.1 SEA 232..327 CDD:279699
CRD_FZ 384..502 CDD:143549
PRKCSH-like <503..>582 CDD:193472
LDLa 536..571 CDD:238060
Tryp_SPc 708..>809 CDD:304450 36/129 (28%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24258
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.