DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG1773 and cfb

DIOPT Version :9

Sequence 1:NP_610512.1 Gene:CG1773 / 35999 FlyBaseID:FBgn0033439 Length:317 Species:Drosophila melanogaster
Sequence 2:XP_021324426.1 Gene:cfb / 30604 ZFINID:ZDB-GENE-980526-487 Length:761 Species:Danio rerio


Alignment Length:294 Identity:71/294 - (24%)
Similarity:116/294 - (39%) Gaps:104/294 - (35%)


- Green bases have known domain annotations that are detailed below.


  Fly    46 CGVLSNLIPAQRLRRRITGGRKSSLLSQPWMAFLHISGDIEMCRCGGSLLSELFVLTAAHCFKMC 110
            ||:..|          ..|..|.|  :.||:|.|.|: ..::..|.|||::..::||||||||..
Zfish   467 CGMQQN----------YDGSNKRS--AYPWLAQLSIA-QSQISDCMGSLVTSRYILTAAHCFKEG 518

  Fly   111 PRSKEIRVWLGE-LDISSTSDCVTYNYQRVCALPVEEFTIDKWILHEEFNL----------FYPG 164
            ....:|.|:|.: .|:.                      ::|..:|..::|          || .
Zfish   519 DTPDKITVYLEKNTDVK----------------------VEKVFIHPNYSLTAKQSIGIKEFY-D 560

  Fly   165 YDIALIKLNKKVVFKDHIRPICLP-------------------------LTDELL--AFTLQLGQ 202
            :|:||::|...|....::||||||                         |::||:  |||.::..
Zfish   561 FDVALLQLKTPVKMSVNLRPICLPCTKETNRALKLSDSQGTCEKHEQILLSNELVDAAFTSKMDM 625

  Fly   203 SYMAVGWGRTESRRFANSTMEVHINTEKC---------------TDGRDTSFLCANGDYVD---- 248
            .       :...|:....|:::....:.|               |:....:|||:.|:...    
Zfish   626 E-------KRSPRKIRRITVKLGKYLDACVEDAKKAKGIEVADATEAVTKNFLCSGGNQPQRDDV 683

  Fly   249 TCTGDSGGPLIWKTTLFGKARTVQFGVVSTGSQN 282
            :|.|:|||    .|.:....|.:|.||||.|.:|
Zfish   684 SCKGESGG----ATHVDKYGRLIQIGVVSWGVKN 713

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG1773NP_610512.1 Tryp_SPc 61..301 CDD:214473 68/279 (24%)
Tryp_SPc 62..301 CDD:238113 68/278 (24%)
cfbXP_021324426.1 CCP 95..150 CDD:153056
CCP 157..210 CDD:153056
vWA_complement_factors 257..455 CDD:238747
Tryp_SPc 478..710 CDD:238113 65/268 (24%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.