DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG1773 and CG18420

DIOPT Version :9

Sequence 1:NP_610512.1 Gene:CG1773 / 35999 FlyBaseID:FBgn0033439 Length:317 Species:Drosophila melanogaster
Sequence 2:NP_995715.1 Gene:CG18420 / 2768924 FlyBaseID:FBgn0028866 Length:299 Species:Drosophila melanogaster


Alignment Length:282 Identity:87/282 - (30%)
Similarity:127/282 - (45%) Gaps:44/282 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    31 TPHELLAYEQLTQQDCGVLSNLIPAQRLRRRITGGRKSSLLSQPWMAFLHISGDIEMCRCGGSLL 95
            |...||...|....:||..|.|    :|..||..|:.:...|.|||||||.|.:  ...|||:|:
  Fly    16 TVFPLLGSTQFLDSECGTRSPL----KLGPRIVNGKVAVRNSSPWMAFLHTSSN--QFICGGTLI 74

  Fly    96 SELFVLTAAHCFKMCPRSKEIRVWLGELDISSTSDCVTYNYQRVCALPVEEFTIDKWILHEEFNL 160
            |...||||||||  .|.: .|.|.|||             |.|......||..:::...|..::.
  Fly    75 SRRLVLTAAHCF--IPNT-TIVVRLGE-------------YNRKLKGYREEHQVNRTFQHRFYDP 123

  Fly   161 FYPGYDIALIKLNKKVVFKDHIRPICLPLTDELLAFTLQLGQSYMAVGWGRTESRRFANSTMEVH 225
            .....||||::|...||:|.:|||||: :.|......:...:.....|||||||...::....:.
  Fly   124 NTHANDIALLRLVSNVVYKANIRPICI-MWDASWKHHIDSIKVLTGTGWGRTESMHDSSELRTLD 187

  Fly   226 INTEKCTDGRDTSFLCANGDYV-----------DTCTGDSGGPLIWKTTLFGKARTVQFGVVSTG 279
            |:       |..|.:||.|..:           :.|.||:|||:..........|.||.|:..| 
  Fly   188 IS-------RQPSKMCAFGSVLSNQFCAGNWNSNLCIGDTGGPVGAMVRYRNAFRFVQVGIAIT- 244

  Fly   280 SQNCGAGQKAYYMDVPTYVPWI 301
            ::.|  .:.:.:.||.:::.:|
  Fly   245 NKRC--QRPSVFTDVMSHIEFI 264

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG1773NP_610512.1 Tryp_SPc 61..301 CDD:214473 77/250 (31%)
Tryp_SPc 62..301 CDD:238113 76/249 (31%)
CG18420NP_995715.1 Tryp_SPc 42..264 CDD:214473 77/250 (31%)
Tryp_SPc 43..267 CDD:238113 77/251 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E33208_3BQ4K
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.