DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG1773 and CG18636

DIOPT Version :9

Sequence 1:NP_610512.1 Gene:CG1773 / 35999 FlyBaseID:FBgn0033439 Length:317 Species:Drosophila melanogaster
Sequence 2:NP_995714.2 Gene:CG18636 / 2768923 FlyBaseID:FBgn0032551 Length:349 Species:Drosophila melanogaster


Alignment Length:274 Identity:91/274 - (33%)
Similarity:134/274 - (48%) Gaps:32/274 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    40 QLTQQDCGVLSNLIPAQRLRRRITGGRKSSLLSQPWMAFLHISGDIEMCRCGGSLLSELFVLTAA 104
            |.....||:.:.    .|...||..|..:...|.|||.|||.:.|  |..|||||:::..|||||
  Fly    27 QFLDPACGIRTQ----SRTAYRIINGHTAKYNSSPWMVFLHSTTD--MFVCGGSLITDKLVLTAA 85

  Fly   105 HCFKMCPRSKEIRVWLGELDISSTSDCVTY--NYQRVCALPVEEFTIDKWILHEEFNLFYPGYDI 167
            |||   ..::.:...|||.:.:.:.:|..|  |::       ||..:|....|:.::......||
  Fly    86 HCF---IANQHLVARLGEYERTRSEECTGYYCNFR-------EEHMVDAGFKHKLYDPNTHANDI 140

  Fly   168 ALIKLNKKVVFKDHIRPICLPLTDELLAFTLQLGQSYMAVGWGRT--ESRRFANSTMEVHIN-TE 229
            |:::|:|.||::|:|||||: :.|......|.......|.|||:|  ||...|..|:::... .:
  Fly   141 AILRLSKSVVYRDNIRPICV-VWDHRWRHYLDKIDLLTATGWGKTQMESDSDALQTLDIRRQPPD 204

  Fly   230 KCTD--GR---DTSFLCANGDYVDTCTGDSGGPLIWKTTLFGKARTVQFGVVSTGSQNCGAGQKA 289
            .|..  |:   ...|...|.| .:.|.|||||||....|.....|.||.|:.|..::||   |||
  Fly   205 VCAKFIGQTIAGNQFCAGNWD-SNLCNGDSGGPLGAVITHKNTQRFVQVGIASYTNRNC---QKA 265

  Fly   290 -YYMDVPTYVPWIL 302
             .:.||.::..:||
  Fly   266 SVFTDVLSHAEFIL 279

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG1773NP_610512.1 Tryp_SPc 61..301 CDD:214473 85/250 (34%)
Tryp_SPc 62..301 CDD:238113 84/249 (34%)
CG18636NP_995714.2 Tryp_SPc 44..278 CDD:214473 85/250 (34%)
Tryp_SPc 45..278 CDD:238113 84/249 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E33208_3BQ4K
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.