DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG1773 and CG33225

DIOPT Version :9

Sequence 1:NP_610512.1 Gene:CG1773 / 35999 FlyBaseID:FBgn0033439 Length:317 Species:Drosophila melanogaster
Sequence 2:NP_001286682.1 Gene:CG33225 / 2768860 FlyBaseID:FBgn0053225 Length:307 Species:Drosophila melanogaster


Alignment Length:303 Identity:104/303 - (34%)
Similarity:148/303 - (48%) Gaps:52/303 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    36 LAYEQLTQQDCGVLSNLIPAQRLRRRITGGRKSSLLSQPWMAFLHISGDIEMCRCGGSLLSELFV 100
            |....|...|||...:  |::  .||:.||..:...:.|||..  :.|:..:. |.|||::.|||
  Fly    35 LGSSTLLTNDCGTTRH--PSR--IRRVVGGNDADRFANPWMVM--VLGENNVF-CSGSLITRLFV 92

  Fly   101 LTAAHCFKMCPRSKEIRVWLGELDISSTS-DCVTYNYQRVCALPVEEFTIDKWILHEEFNL-FYP 163
            ||:|.|....|:    :|.|||.|.:.|| ||.:..         :...||:.|:|.:|.| ...
  Fly    93 LTSASCLLSLPK----QVILGEYDRNCTSADCTSIR---------QVIDIDQKIIHGQFGLETVK 144

  Fly   164 GYDIALIKLNKKVVFKDHIRPICLPLTDELLAFTLQLGQS---YMAVGWGRTESRRFANSTMEV- 224
            .|||||::|.|||...|::||||       |:...|:|:|   :.|.|||.||....:.....| 
  Fly   145 KYDIALLRLAKKVSISDYVRPIC-------LSVDRQVGRSVQHFTATGWGTTEWNEPSTILQTVT 202

  Fly   225 --HINTEKCTDGR-----DTSFLCANGDYVDTCTGDSGGPLIWKTTLFG------KARTVQFGVV 276
              .||.:.| .||     |.|.||..|...|||:||:||||.....:.|      |:|....|:|
  Fly   203 LSKINRKYC-KGRLRQNIDASQLCVGGPRKDTCSGDAGGPLSLTLKIDGDGKWNNKSRAFLIGIV 266

  Fly   277 STGSQNC-GAGQKAYYMDVPTYVPWILAKMAELSDFK-GSLHR 317
            |.||.:| |.|   .|.:|..|:.||:..:.:.:..| .::||
  Fly   267 SYGSSSCSGIG---VYTNVEHYMDWIVRTINKSNTEKIANVHR 306

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG1773NP_610512.1 Tryp_SPc 61..301 CDD:214473 92/259 (36%)
Tryp_SPc 62..301 CDD:238113 91/258 (35%)
CG33225NP_001286682.1 Tryp_SPc 56..289 CDD:214473 92/259 (36%)
Tryp_SPc 57..292 CDD:238113 93/261 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E33208_3BQ4K
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG25819
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.