DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG1773 and CG33226

DIOPT Version :9

Sequence 1:NP_610512.1 Gene:CG1773 / 35999 FlyBaseID:FBgn0033439 Length:317 Species:Drosophila melanogaster
Sequence 2:NP_995917.3 Gene:CG33226 / 2768859 FlyBaseID:FBgn0069056 Length:292 Species:Drosophila melanogaster


Alignment Length:298 Identity:95/298 - (31%)
Similarity:130/298 - (43%) Gaps:67/298 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    35 LLAYEQLTQQ----DC-----GVLSNLIPAQRLRRRITGGRKSSLLSQPWMAFL-----HISGDI 85
            |.:||.|.|.    :|     ||          |.:|.||..:.:...|||..:     |.    
  Fly    21 LRSYESLGQDLLDPNCVQTPVGV----------REQILGGHNADIKLHPWMVQILQRGYHF---- 71

  Fly    86 EMCRCGGSLLSELFVLTAAHCFKMCPRSKEIRVWLGELDISSTSDCVTYNY---QRVCALPVEEF 147
                |||||:|.|||||||||..    ...::|..|..      ..:|..|   .:.|:....|.
  Fly    72 ----CGGSLISSLFVLTAAHCHS----RYRLKVRFGRY------SGITPRYLCSSQYCSPFGPEI 122

  Fly   148 TIDKWILHEEFNLFYPGYDIALIKLNKKVVFKDHIRPICLPLT---DELLAFTLQLGQSYMAV-- 207
            .:.:..||..:. .|..|||||..|.|.|.:....||||:..|   |:|..|.     :|:|:  
  Fly   123 DVKRIFLHSSYR-DYHNYDIALFLLAKPVRYNVQTRPICVLQTSNKDKLRQFL-----NYVAMFN 181

  Fly   208 --GWGRTESR---RFANSTMEVHINTEKCTDGRDTSF----LCANGDYVDTCTGDSGGPLIWKTT 263
              |||:|||:   ....:|...|::.:.|....|...    :||......||||||||||..:.|
  Fly   182 VTGWGKTESQLTSTILQTTSLFHLDRKFCAQIFDRKIGWPHICAGHSQSSTCTGDSGGPLSAELT 246

  Fly   264 LFGKARTVQFGVVSTGSQNCGAGQKAYYMDVPTYVPWI 301
            ..|..|||.||::|.|:.||  .:...:.:|..|..||
  Fly   247 FSGVKRTVLFGIISYGAPNC--REVTVFTNVLRYSNWI 282

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG1773NP_610512.1 Tryp_SPc 61..301 CDD:214473 84/261 (32%)
Tryp_SPc 62..301 CDD:238113 84/260 (32%)
CG33226NP_995917.3 Tryp_SPc 47..285 CDD:238113 86/262 (33%)
Tryp_SPc 47..282 CDD:214473 84/260 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E33208_3BQ4K
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.