DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG1773 and CG33462

DIOPT Version :9

Sequence 1:NP_610512.1 Gene:CG1773 / 35999 FlyBaseID:FBgn0033439 Length:317 Species:Drosophila melanogaster
Sequence 2:NP_995844.2 Gene:CG33462 / 2768841 FlyBaseID:FBgn0053462 Length:300 Species:Drosophila melanogaster


Alignment Length:311 Identity:90/311 - (28%)
Similarity:136/311 - (43%) Gaps:66/311 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    11 IWGILCLSCPPSSQAGREDWTPHELLAYEQLTQQDCGVLSNLIPAQRLRRRITGGRKSSLLSQPW 75
            |.||..:.|.         |  ..:..::.|.::|||:..|:  ::|       ...:.|...||
  Fly     5 IIGIAVICCL---------W--RRVQGFQMLLEEDCGIPHNI--SER-------SVNAKLAQNPW 49

  Fly    76 MAFLHISGDIEMCRCGGSLLSELFVLTAAHCFKMCPRSKEIRVWLGELDISSTSDCVTYNYQRVC 140
            ||:|......   .|.|:|::.|||||||||   .|....|.|.|||.:..:..||..:    :|
  Fly    50 MAYLETPKGF---HCSGTLINHLFVLTAAHC---VPDDLLITVRLGEYNTKTKVDCDNH----LC 104

  Fly   141 ALPVEEFTIDKWILHEEFNLFYPGYDIALIKLNKKVVFKDHIRPICL--------PLTDELLAFT 197
            ..|.:|:.:|....|..:|......||.:::|.::|.:.:||||||:        |: |:|..||
  Fly   105 QEPFQEYNVDMGFRHRYYNANDQTNDIGMLRLGRRVEYLNHIRPICIFASNRFQEPI-DQLTWFT 168

  Fly   198 LQLGQSYMAVGWGRTESRRFANSTMEVHINT--------EKCTD--GRDTSF--LCANGDYVDTC 250
            ..:        |..|.    ||:|.:| :.|        |.|::  |.:.:|  :||.......|
  Fly   169 TTV--------WRETA----ANATSKV-LRTMNIDRQPKETCSEIYGWNMTFEQICAGNTLSQLC 220

  Fly   251 TGDSGGPLIWKTTLFGKARTVQFGVVSTGSQNCGAGQKAYYMDVPTYVPWI 301
            :.|||.|.|.|....|..|.||.|:.|.....|  ......||:.:|..||
  Fly   221 STDSGAPQIRKMWHNGSDRYVQLGIASRVKGQC--QNSGILMDLLSYADWI 269

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG1773NP_610512.1 Tryp_SPc 61..301 CDD:214473 77/259 (30%)
Tryp_SPc 62..301 CDD:238113 77/258 (30%)
CG33462NP_995844.2 Tryp_SPc 48..272 CDD:238113 78/248 (31%)
Tryp_SPc 48..269 CDD:214473 76/246 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E33208_3BQ4K
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.