DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG1773 and CG33461

DIOPT Version :9

Sequence 1:NP_610512.1 Gene:CG1773 / 35999 FlyBaseID:FBgn0033439 Length:317 Species:Drosophila melanogaster
Sequence 2:NP_995843.3 Gene:CG33461 / 2768840 FlyBaseID:FBgn0053461 Length:287 Species:Drosophila melanogaster


Alignment Length:279 Identity:85/279 - (30%)
Similarity:126/279 - (45%) Gaps:49/279 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    43 QQDCGVLSNLIPAQRLRRRITGGRKSSLLSQPWMAFLHISGDIEMCRCGGSLLSELFVLTAAHCF 107
            :::|||    :|  ||..:|..|..:.|...|||||||..   ....|.|||:::.||||:|||.
  Fly    29 EENCGV----VP--RLSYKIINGTPARLGRYPWMAFLHTP---TYFLCAGSLINQWFVLTSAHCI 84

  Fly   108 KMCPRSKEIRVWLGELDISSTSDCVTYNYQRVCALPVEEFTIDKWILHEEFNLFYP---GYDIAL 169
            :   ...|:...|||.:..:..||....    |....:|:.:|....|   .|:.|   ..||.:
  Fly    85 E---DDVELIARLGENNRDNDIDCENNR----CLEATQEYNVDMLFKH---RLYDPKDFSNDIGM 139

  Fly   170 IKLNKKVVFKDHIRPICL-------PLTDELLAFTLQLGQSYMAVGWGRTESRRFANST---MEV 224
            ::|.::|.:..||:|||:       .:.|::..|        .|.|||.|.:.....|:   ||:
  Fly   140 LRLERRVEYTYHIQPICIFHHRRMQLVVDQITWF--------KATGWGLTSTDLNTKSSRVLMEL 196

  Fly   225 HI---NTEKCTDGRDTSFL----CANGDYVDTCTGDSGGPLIWKTTLFGKARTVQFGVVSTGSQN 282
            ::   ....|......:||    ||..|..:.|.||||||......:||..|.||.|:.|...:|
  Fly   197 NLYRRPRNDCARIFKQNFLSGQICAGNDDGNLCRGDSGGPQGRYVLIFGMKRFVQMGIASFTYEN 261

  Fly   283 CGAGQKAYYMDVPTYVPWI 301
            |  .:.:...||..|..||
  Fly   262 C--SKVSILTDVVRYGRWI 278

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG1773NP_610512.1 Tryp_SPc 61..301 CDD:214473 77/259 (30%)
Tryp_SPc 62..301 CDD:238113 77/258 (30%)
CG33461NP_995843.3 Tryp_SPc 41..278 CDD:214473 77/259 (30%)
Tryp_SPc 42..281 CDD:238113 79/260 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E33208_3BQ4K
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.