DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG1773 and Sp212

DIOPT Version :9

Sequence 1:NP_610512.1 Gene:CG1773 / 35999 FlyBaseID:FBgn0033439 Length:317 Species:Drosophila melanogaster
Sequence 2:NP_996209.2 Gene:Sp212 / 2768666 FlyBaseID:FBgn0053329 Length:516 Species:Drosophila melanogaster


Alignment Length:308 Identity:82/308 - (26%)
Similarity:119/308 - (38%) Gaps:63/308 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    17 LSCPPSSQAGREDWTPHELLAYEQLTQQDCGVLSNLIPAQRLRRRITGGRKSSLLSQPWM-AFLH 80
            ::.||::.      .|.......|::...||...:..|.      |..|.:......||: |..|
  Fly   244 VTVPPATP------PPQRFDPRSQISSVVCGREGSTTPF------IVRGNEFPRGQYPWLSAVYH 296

  Fly    81 ISGDIEMCRCGGSLLSELFVLTAAHCFKMCPRSKEIRVWLG----ELDISSTSDCVTYNYQRVCA 141
            ........:|.|||:|...|::||||..   |..|.||.:|    :||..........|..|:. 
  Fly   297 KEVRALAFKCRGSLISSSIVISAAHCVH---RMTEDRVVVGLGRYDLDDYGEDGAEMRNVMRLL- 357

  Fly   142 LPVEEFTIDKWILHEEFNL-FYPGYDIALIKLNKKVVFKDHIRPICLPLTDELLAFTLQLGQSY- 204
                      |  |.::|. .|...|||||.:.:.|.|.|.|.|||:        :|::..::. 
  Fly   358 ----------W--HPDYNTRSYSDADIALITIERPVTFNDIIAPICM--------WTVEASRTVS 402

  Fly   205 ---MAVGWGRTE--SRRFANSTMEVHI-------NTEKCTDGRDTSFLCANGDYVDTCTGDSGGP 257
               ...||||.|  ||......:|..|       :|.:.|...:.|....|.|....|.|||||.
  Fly   403 TTGFIAGWGRDEDSSRTQYPRVVEAEIASPTVCASTWRGTMVTERSLCAGNRDGSGPCVGDSGGG 467

  Fly   258 LIWKTTLFGKARTVQFGVVSTGSQ----NCGAGQKAYYMDVPTYVPWI 301
            |:.|.    ..|.:..|:||.|.:    .|...|...|.|:..::.||
  Fly   468 LMVKQ----GDRWLLRGIVSAGERGPAGTCQLNQYVLYCDLSKHINWI 511

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG1773NP_610512.1 Tryp_SPc 61..301 CDD:214473 73/262 (28%)
Tryp_SPc 62..301 CDD:238113 73/261 (28%)
Sp212NP_996209.2 GD_N 23..122 CDD:292649
Tryp_SPc 277..514 CDD:238113 75/263 (29%)
Tryp_SPc 277..511 CDD:214473 73/261 (28%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24258
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.