DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG1773 and Klk8

DIOPT Version :9

Sequence 1:NP_610512.1 Gene:CG1773 / 35999 FlyBaseID:FBgn0033439 Length:317 Species:Drosophila melanogaster
Sequence 2:NP_001311327.1 Gene:Klk8 / 259277 MGIID:1343327 Length:260 Species:Mus musculus


Alignment Length:279 Identity:86/279 - (30%)
Similarity:119/279 - (42%) Gaps:62/279 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    47 GVLSNLIPAQRLRRRITGGRKSSLLSQPWMAFLHISGDIEMCRCGGSLLSELFVLTAAHCFKMCP 111
            |..:.|..||  ..:|..||:....||||.|.| ..|  |...|||.|:.:.:|||||||     
Mouse    20 GAWAGLTRAQ--GSKILEGRECIPHSQPWQAAL-FQG--ERLICGGVLVGDRWVLTAAHC----- 74

  Fly   112 RSKEIRVWLGELDISSTSDCVTYNYQRVCALPVEEFTIDKWILHEEFNLFYP---GYDIALIKLN 173
            :.::..|.||:..:.|...            |.:|..:.:.|.|..:|...|   .:||.||:|.
Mouse    75 KKQKYSVRLGDHSLQSRDQ------------PEQEIQVAQSIQHPCYNNSNPEDHSHDIMLIRLQ 127

  Fly   174 KKVVFKDHIRPICLPLTDELLAFTLQLGQSYMAVGWGRTES--RRFAN--STMEVHINTE-KC-- 231
            ......|.::|:      :|.....::||..:..|||...|  ..|.|  :..||.|.:: ||  
Mouse   128 NSANLGDKVKPV------QLANLCPKVGQKCIISGWGTVTSPQENFPNTLNCAEVKIYSQNKCER 186

  Fly   232 ------TDGRDTSFLCA---NGDYVDTCTGDSGGPLIWKTTLFGKARTVQFGVVSTGSQNCGAGQ 287
                  |:|    .:||   ||  .|||.|||||||:....|        .|:.|.||..||..:
Mouse   187 AYPGKITEG----MVCAGSSNG--ADTCQGDSGGPLVCDGML--------QGITSWGSDPCGKPE 237

  Fly   288 K-AYYMDVPTYVPWILAKM 305
            | ..|..:..|..||...|
Mouse   238 KPGVYTKICRYTTWIKKTM 256

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG1773NP_610512.1 Tryp_SPc 61..301 CDD:214473 79/259 (31%)
Tryp_SPc 62..301 CDD:238113 79/258 (31%)
Klk8NP_001311327.1 Tryp_SPc 32..252 CDD:214473 79/259 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.