DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG1773 and CG30375

DIOPT Version :9

Sequence 1:NP_610512.1 Gene:CG1773 / 35999 FlyBaseID:FBgn0033439 Length:317 Species:Drosophila melanogaster
Sequence 2:NP_724665.1 Gene:CG30375 / 246575 FlyBaseID:FBgn0050375 Length:398 Species:Drosophila melanogaster


Alignment Length:276 Identity:72/276 - (26%)
Similarity:118/276 - (42%) Gaps:62/276 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    39 EQLTQQDCGVLSNLIPAQ---RLRRRITGGRKSSLLSQPWMAFLH-ISGDIEMCRCGGSLLSELF 99
            :|.::.:|..::...|..   ....||..|.::.....|.|..|. :|.::.:. ||||::||.:
  Fly   126 QQRSRLNCQAVARPAPCDCGWSFPNRIANGVEAGKHEFPSMVGLRDLSSNLPIF-CGGSIVSERY 189

  Fly   100 VLTAAHCFKMCPRSKEIRVWLGELDISSTSDCV---TYNYQRVCALPVEEFTIDKWILHEEFNLF 161
            ::|||||....|.:..:...:||.|:|:.::.:   .|..|.:                    :.
  Fly   190 IMTAAHCTARQPVASRLLALVGEHDLSTGAESIYAAQYRIQNI--------------------IN 234

  Fly   162 YPGY---------DIALIKLNKKVVFKDHIRPICLPLTDELLAFTLQLGQSYMAVGWGRTESRRF 217
            :|||         ||||::....:.:...:.|||||:.....:|..   |:...:|||   :..|
  Fly   235 HPGYMETASGNINDIALLQTATPIEWSRGVAPICLPIRQAENSFNY---QNVDIMGWG---TLGF 293

  Fly   218 ANS-----------TMEVHINTEKCTDGRDTSFLC---ANGDYVDTCTGDSGGPLIWKTTLFGKA 268
            |.|           ||:..:...:.......|.||   |.|...|:|..|||||:|    |..:.
  Fly   294 AASKSNTLQKATLLTMDNAVCRSRFNSSITPSHLCTYDAGGRGQDSCQYDSGGPVI----LRQRE 354

  Fly   269 RTVQFGVVSTGSQNCG 284
            |..|.||:|.| :.||
  Fly   355 RMFQLGVISYG-RACG 369

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG1773NP_610512.1 Tryp_SPc 61..301 CDD:214473 69/251 (27%)
Tryp_SPc 62..301 CDD:238113 68/250 (27%)
CG30375NP_724665.1 CUB 38..>100 CDD:294042
Tryp_SPc 151..386 CDD:214473 69/251 (27%)
Tryp_SPc 152..387 CDD:238113 68/250 (27%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45456003
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24258
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.