DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG1773 and CG30289

DIOPT Version :9

Sequence 1:NP_610512.1 Gene:CG1773 / 35999 FlyBaseID:FBgn0033439 Length:317 Species:Drosophila melanogaster
Sequence 2:NP_726081.1 Gene:CG30289 / 246532 FlyBaseID:FBgn0050289 Length:316 Species:Drosophila melanogaster


Alignment Length:319 Identity:96/319 - (30%)
Similarity:151/319 - (47%) Gaps:48/319 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 ITALIWGILCLSCPPSSQAGREDWTPHELLAYEQLTQQDCGVLSN--LIPAQRLRRRITGGRKSS 69
            |.|:|..::||....::...|             |..::||:..:  .:|      .|.||.|::
  Fly     4 INAVIAALVCLFIANNNVMSR-------------LLVENCGISKDDPYVP------NIFGGAKTN 49

  Fly    70 LLSQPWMAFLHISGDIEMCRCGGSLLSELFVLTAAHCFKMCPRSKEIRVWLGELDISSTSDCVTY 134
            :...|||..:..|..     |||||::..||||||||...    :::.|.||:.:   |.|.:.|
  Fly    50 IQENPWMVLVWSSKP-----CGGSLIARQFVLTAAHCVSF----EDLYVRLGDYE---TLDPMPY 102

  Fly   135 NYQRVCALPVEEFTIDKWILHEEFNLFYPGYDIALIKLNKKVVFKDHIRPICLPLTDELLAFTLQ 199
            .....|.......::|..|:||.:|......||||:::::.|.:.|::|||||.:.:::.:..: 
  Fly   103 CLNNHCIPKFYNISVDMKIVHENYNGITLQNDIALLRMSEAVEYSDYVRPICLLVGEQMQSIPM- 166

  Fly   200 LGQSYMAVGWGRTE----SRRFANST---MEVHINTEKCTDGRDTSFLCANGDYVDTCTGDSGGP 257
                :...|||.||    ||...|:|   |::.....|.....|.|.:||.....:||.||||||
  Fly   167 ----FTVTGWGETEYGQFSRILLNATLYNMDISYCNIKFNKQADRSQICAGSHTSNTCKGDSGGP 227

  Fly   258 LIWKTTLFGKARTVQFGVVSTGSQNCGAGQKAYYMDVPTYVPWILAKMAELSDFKGSLH 316
            |..|.....:..:.|:|:||.||:.|.|.....|.:|..:..||..||.:   ||.:.|
  Fly   228 LSSKFHYGNRLLSFQYGLVSYGSERCAANVAGVYTNVSYHREWIFNKMVQ---FKPTGH 283

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG1773NP_610512.1 Tryp_SPc 61..301 CDD:214473 79/246 (32%)
Tryp_SPc 62..301 CDD:238113 79/245 (32%)
CG30289NP_726081.1 Tryp_SPc 42..271 CDD:214473 79/245 (32%)
Tryp_SPc 42..271 CDD:238113 79/245 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E33208_3BQ4K
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.