DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG1773 and CG30288

DIOPT Version :9

Sequence 1:NP_610512.1 Gene:CG1773 / 35999 FlyBaseID:FBgn0033439 Length:317 Species:Drosophila melanogaster
Sequence 2:NP_001097398.1 Gene:CG30288 / 246531 FlyBaseID:FBgn0050288 Length:282 Species:Drosophila melanogaster


Alignment Length:314 Identity:107/314 - (34%)
Similarity:148/314 - (47%) Gaps:55/314 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 ITALIWGILCLSCPPSSQAGREDWTPHELLAYEQLTQQDCGVLSNLIPAQRLRRRITGGRKSSLL 71
            :..|..||:      .:::||             |.:.|||..|    :...|.||.|||.:.:.
  Fly    11 VACLFIGII------RTESGR-------------LLENDCGTTS----SNGYRARIDGGRDAGME 52

  Fly    72 SQPWMAFLHISGDIEMCRCGGSLLSELFVLTAAHCFKMCPRSKEIRVWLGELDI-SSTSDCVTYN 135
            |.|||..:.|||   ...|||||::..|||||.||  :.|....:|  |||.|. ....||..: 
  Fly    53 SNPWMVRVMISG---KAVCGGSLITARFVLTAEHC--ISPMYMNVR--LGEYDTRHPIFDCDDF- 109

  Fly   136 YQRVCALPVEEFTIDKWILHEEFNLFYPGYDIALIKLNKKVVFKDHIRPICLPLTDELLAFTLQL 200
               ||........:|:.|:|..     |||||.|:::.:.|:|.:::|||||.|...|....|.:
  Fly   110 ---VCTPRAYNVDVDRKIVHSN-----PGYDIGLLRMQRSVIFSNYVRPICLILGKTLGGNPLSI 166

  Fly   201 GQSYMAVGWGRT----ESRRFANSTMEVHINTEKC-TDGR--DTSFLCANGDYV-DTCTGDSGGP 257
             ..:...|||..    |..|...:|:: .:....| ..||  |.|::|| |.|: |:|.||||||
  Fly   167 -LRFNFTGWGTNSDGEEQDRLQTATLQ-QLPQWSCERPGRPLDISYICA-GSYISDSCKGDSGGP 228

  Fly   258 LIWKTTLFGKARTVQFGVVSTGSQNC-GAGQKAYYMDVPTYVPWILAKMAELSD 310
            |....|..|:.|..||||.|.|.:.| |.|   .|.:|..:..|||..:...||
  Fly   229 LSAIRTFEGQGRVFQFGVASQGLRLCSGLG---IYTNVTHFTDWILDVIQNHSD 279

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG1773NP_610512.1 Tryp_SPc 61..301 CDD:214473 91/249 (37%)
Tryp_SPc 62..301 CDD:238113 90/248 (36%)
CG30288NP_001097398.1 Tryp_SPc 42..270 CDD:214473 91/249 (37%)
Tryp_SPc 45..270 CDD:238113 89/246 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E33208_3BQ4K
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.