DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG1773 and CG30287

DIOPT Version :9

Sequence 1:NP_610512.1 Gene:CG1773 / 35999 FlyBaseID:FBgn0033439 Length:317 Species:Drosophila melanogaster
Sequence 2:NP_726083.1 Gene:CG30287 / 246530 FlyBaseID:FBgn0050287 Length:284 Species:Drosophila melanogaster


Alignment Length:259 Identity:83/259 - (32%)
Similarity:119/259 - (45%) Gaps:40/259 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    61 RITGGRKSSLLSQPWMAFLHISGDIEMCRCGGSLLSELFVLTAAHCFKMCPRSKEIRVWLGELDI 125
            |:..|:.:.|.|.|||..:...|   |.:|||||::..:|||||||  ......::.|.||:.|:
  Fly    41 RVINGKPADLFSNPWMVIIIERG---MMKCGGSLITPRYVLTAAHC--KSETKSQLTVRLGDYDV 100

  Fly   126 SSTSDCVTYNYQRVCALPVEEFTIDKWILHEEFNLFYPGYDIALIKLNKKVVFKDHIRPICLPLT 190
            :...||.:|.    |.....|..:.:..:...:..|... ||||::|...|.:.|:||.|||.:.
  Fly   101 NQAVDCSSYG----CIPRPREINVTRTYVPSHYTNFRKN-DIALLRLETTVQYGDNIRSICLLMG 160

  Fly   191 D---------ELLAFTLQLGQSYMAVGWGRTESRRFANSTM-----EVHINTEKCTD--GR--DT 237
            |         .|:.|.        ..||||||||  .||.:     ..|.:...|..  |:  |.
  Fly   161 DYTWSSNILKNLVKFN--------TTGWGRTESR--INSPVLQQASLTHHHLSYCAQVFGKQLDK 215

  Fly   238 SFLCANGDYVDTCTGDSGGPLIWKTTLFGKARTVQFGVVSTGSQNCGAGQKAYYMDVPTYVPWI 301
            |.:|.......||.|||||||..:..:..:.|.:.|||||.|:.:|..  ...|.:|..:..||
  Fly   216 SHICVASSTGSTCQGDSGGPLTARVRIGSERRVILFGVVSYGAVHCFG--PTVYTNVIHFANWI 277

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG1773NP_610512.1 Tryp_SPc 61..301 CDD:214473 81/257 (32%)
Tryp_SPc 62..301 CDD:238113 80/256 (31%)
CG30287NP_726083.1 Tryp_SPc 41..277 CDD:214473 81/257 (32%)
Tryp_SPc 42..280 CDD:238113 82/258 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E33208_3BQ4K
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG25819
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.