DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG1773 and CG30090

DIOPT Version :9

Sequence 1:NP_610512.1 Gene:CG1773 / 35999 FlyBaseID:FBgn0033439 Length:317 Species:Drosophila melanogaster
Sequence 2:NP_725487.1 Gene:CG30090 / 246448 FlyBaseID:FBgn0050090 Length:291 Species:Drosophila melanogaster


Alignment Length:311 Identity:107/311 - (34%)
Similarity:150/311 - (48%) Gaps:61/311 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 ITALIWGILCLSCPPSSQAGREDWTPHELLAYEQLTQQDCGVLSNLIPAQRLRRRITGGRKSSLL 71
            ||||..|:||                  .|...:..:..||:.:|.|..     :|.|||.:.:.
  Fly     8 ITALAIGVLC------------------SLGNGEYLEPRCGLTANTIAF-----KIIGGRDAIIN 49

  Fly    72 SQPWMAFLHISGDIEMCRCGGSLLSELFVLTAAHCFKMCPRSKEIRVWLGELDISSTSDCVTYNY 136
            |.||||::|.|  :::. |||:|:::.||||||||..   ....::|.|||.|.::|.||    .
  Fly    50 SNPWMAYIHSS--VKLI-CGGTLITQRFVLTAAHCVN---EGSAVKVRLGEYDDTATEDC----N 104

  Fly   137 QRVCALPVEEFTIDKWILHEEFNLFYPGYDIALIKLNKKVVFKDHIRPICL-------PLTDELL 194
            .::|....||..:|....|.:|:......||||::|.|.|.||.||.|||:       .|.|.: 
  Fly   105 SKICIPRAEEHDVDMAFRHGKFSEIKNLNDIALLRLAKFVTFKAHISPICIILGTSKRELVDSI- 168

  Fly   195 AFTLQLGQSYMAVGWGRTESRRFANSTMEV----HINTEKCTD--GR--DTSFLCANGDYVDTCT 251
                   :.::|.|||.|.:.| ....:::    ..|:.:|..  ||  ..:.:||.....|||.
  Fly   169 -------EWFVATGWGETRTHR-TRGVLQITQLQRYNSSQCMQALGRLVQQNQICAGRLGSDTCN 225

  Fly   252 GDSGGPLIWKTTLFGKARTVQFGVVSTGSQNC-GAGQKAYYMDVPTYVPWI 301
            |||||||........|.|.|||||||.||:.| |.|   .|.||.:|..||
  Fly   226 GDSGGPLFQTVRHMDKMRPVQFGVVSYGSRECSGIG---VYTDVYSYADWI 273

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG1773NP_610512.1 Tryp_SPc 61..301 CDD:214473 93/255 (36%)
Tryp_SPc 62..301 CDD:238113 93/254 (37%)
CG30090NP_725487.1 Tryp_SPc 39..273 CDD:214473 93/255 (36%)
Tryp_SPc 40..276 CDD:238113 95/256 (37%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E33208_3BQ4K
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.