DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG1773 and CG30087

DIOPT Version :9

Sequence 1:NP_610512.1 Gene:CG1773 / 35999 FlyBaseID:FBgn0033439 Length:317 Species:Drosophila melanogaster
Sequence 2:NP_725489.2 Gene:CG30087 / 246446 FlyBaseID:FBgn0050087 Length:277 Species:Drosophila melanogaster


Alignment Length:274 Identity:89/274 - (32%)
Similarity:134/274 - (48%) Gaps:43/274 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    46 CGVLSNLIPAQRLRRRITGGRKSSLLSQPWMAFLHISGDIEMCRCGGSLLSELFVLTAAHCFKMC 110
            |||...    .:...|:..|:::.:.|.|:|.::   .:..:..||||:|:..::||||||  :.
  Fly    30 CGVTYE----SQTAMRVVNGKEAVIRSAPFMVYV---TNNSLTHCGGSILNSRYILTAAHC--VF 85

  Fly   111 PRSKEIRVWLGELDISSTSDCVTYNYQRVCALPVEEFTIDKWILHEEFNLFYPGYDIALIKLNKK 175
            |   .:|:.|||.:|.:..||...|    |:...||:.|.|.|.|..:|......||||:|||:.
  Fly    86 P---NLRLRLGEHNIRTDPDCQGSN----CSPRSEEYGIMKAITHRFYNAANHVNDIALLKLNRS 143

  Fly   176 VVFKDHIRPICL---PLTDELLAFTLQLGQSYMAVGWGRTESRRFAN--STMEVH-INTEKCTDG 234
            :.|..||:|||:   |.:...:|       :|...|||.|:...|.:  .|.|:. .:...|:  
  Fly   144 INFNVHIQPICILLNPASAPSVA-------TYQTFGWGETKKNGFPHLLQTAELRAYDAAYCS-- 199

  Fly   235 RDTSF--------LCANGDYVDTCTGDSGGPLIWKTTLFGKARTVQFGVVSTGSQNCGAGQKAYY 291
              .||        :||..:..|||.|||||||:.:....|..|.:|.|:||.|..:|.:  ...|
  Fly   200 --RSFHAYMNGNQICAGHEERDTCAGDSGGPLVTRVDFDGVKRYLQLGIVSYGPTDCQS--PGVY 260

  Fly   292 MDVPTYVPWILAKM 305
            ..||.|:.||...|
  Fly   261 TYVPNYINWIRRAM 274

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG1773NP_610512.1 Tryp_SPc 61..301 CDD:214473 83/253 (33%)
Tryp_SPc 62..301 CDD:238113 82/252 (33%)
CG30087NP_725489.2 Tryp_SPc 41..270 CDD:214473 83/253 (33%)
Tryp_SPc 42..272 CDD:238113 84/254 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.