DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG1773 and CG30083

DIOPT Version :9

Sequence 1:NP_610512.1 Gene:CG1773 / 35999 FlyBaseID:FBgn0033439 Length:317 Species:Drosophila melanogaster
Sequence 2:NP_725492.3 Gene:CG30083 / 246444 FlyBaseID:FBgn0050083 Length:279 Species:Drosophila melanogaster


Alignment Length:275 Identity:83/275 - (30%)
Similarity:131/275 - (47%) Gaps:43/275 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    37 AYEQLTQQDCGVLSNLIPAQRLRRRITGGRKSSLLSQPWMAFLHISGDIEMCR--CGGSLLSELF 99
            |..|..:.:|| ..::.|      :|..|:.:...:.||||::....|.|:..  |||:|:.:.|
  Fly    16 AMSQFLEPNCG-YPDISP------KIMHGQNAENGTNPWMAYIFKYNDKEVAELVCGGTLIHKQF 73

  Fly   100 VLTAAHCFKMCPRSKEIRVWLGELDISSTSDCVTYNYQRVCALPVEEFTIDKWILHEEFNLFYPG 164
            ||:||||.|   |.:.:.|.|||...|                  ..|.:.|...::.|......
  Fly    74 VLSAAHCIK---RDQILAVRLGEHSSS------------------RYFAVTKAFRNKYFTTGSYS 117

  Fly   165 YDIALIKLNKKVVFKDHIRPICLPLTDELLAFTLQLGQSYMAVGWGRTESRRFAN--STMEVH-I 226
            .||.::::...|.|...|||||: :||......:   :::.|.|||:||:..|:.  .|:|:: :
  Fly   118 NDIGILRIQPIVKFNAVIRPICI-ITDPTKVPNV---KTFKAAGWGKTENETFSKVLKTVELNEL 178

  Fly   227 NTEKCTD----GRDTSFLCANGDYVDTCTGDSGGPLIWKTTLFGKARTVQFGVVSTGSQNCGAGQ 287
            |..:|.:    ....|.:||.....|||.||||||||....:.|..|.||.|::|.||..|.:  
  Fly   179 NASECYNMLWVNVTESQICAGHPDGDTCAGDSGGPLIHPVYMDGSLRYVQLGIISFGSSLCNS-- 241

  Fly   288 KAYYMDVPTYVPWIL 302
            ...|..:.:::.|||
  Fly   242 PGVYTRLSSFIDWIL 256

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG1773NP_610512.1 Tryp_SPc 61..301 CDD:214473 75/248 (30%)
Tryp_SPc 62..301 CDD:238113 75/247 (30%)
CG30083NP_725492.3 Tryp_SPc 33..255 CDD:214473 75/248 (30%)
Tryp_SPc 34..255 CDD:238113 75/247 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E33208_3BQ4K
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.