DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG1773 and Klk1b3

DIOPT Version :9

Sequence 1:NP_610512.1 Gene:CG1773 / 35999 FlyBaseID:FBgn0033439 Length:317 Species:Drosophila melanogaster
Sequence 2:NP_113711.1 Gene:Klk1b3 / 24594 RGDID:3175 Length:265 Species:Rattus norvegicus


Alignment Length:277 Identity:76/277 - (27%)
Similarity:116/277 - (41%) Gaps:59/277 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    55 AQRLRRRITGGRKSSLLSQPWMAFLHISGDIEMCRCGGSLLSELFVLTAAHCFKMCPRSKEIRVW 119
            |..::.|:.||....:.||||...::..|:.   .|||.|:...:|:|||||     .:...:||
  Rat    22 APPVQSRVVGGYNCEMNSQPWQVAVYYFGEY---LCGGVLIDPSWVITAAHC-----ATDNYQVW 78

  Fly   120 LGELDISSTSDCVTYNYQRVCALPVEEFTIDKWILHEEFN--LFY-----PG----YDIALIKLN 173
            ||..::........:.      |..:.|.      |..||  |.:     ||    .|:.|:.|:
  Rat    79 LGRNNLYEDEPFAQHR------LVSQSFP------HPGFNQDLIWNHTRQPGDDYSNDLMLLHLS 131

  Fly   174 KKVVFKDHIRPICLPLTDELLAFTLQLGQSYMAVGWG--RTESRRFANSTMEVHI---NTEKCTD 233
            :.....|.::.|.||:.:.      ::|.:.:|.|||  ..:....::....|:|   :.|||.:
  Rat   132 QPADITDGVKVIDLPIEEP------KVGSTCLASGWGSITPDGLELSDDLQCVNIDLLSNEKCVE 190

  Fly   234 GRDTS----FLCANGDY---VDTCTGDSGGPLIWKTTLFGKARTVQFGVVSTGSQNCGAGQK-AY 290
            .....    .||| |:.   .|||.||||||||        ...|..|:.|.|...||..:| ..
  Rat   191 AHKEEVTDLMLCA-GEMDGGKDTCKGDSGGPLI--------CNGVLQGITSWGFNPCGEPKKPGI 246

  Fly   291 YMDVPTYVPWILAKMAE 307
            |..:..:.|||...|.|
  Rat   247 YTKLIKFTPWIKEVMKE 263

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG1773NP_610512.1 Tryp_SPc 61..301 CDD:214473 71/263 (27%)
Tryp_SPc 62..301 CDD:238113 70/262 (27%)
Klk1b3NP_113711.1 Tryp_SPc 28..257 CDD:214473 71/263 (27%)
Tryp_SPc 29..260 CDD:238113 72/265 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
00.000

Return to query results.
Submit another query.