DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG1773 and Cela2a

DIOPT Version :9

Sequence 1:NP_610512.1 Gene:CG1773 / 35999 FlyBaseID:FBgn0033439 Length:317 Species:Drosophila melanogaster
Sequence 2:NP_036685.1 Gene:Cela2a / 24332 RGDID:2548 Length:271 Species:Rattus norvegicus


Alignment Length:289 Identity:83/289 - (28%)
Similarity:129/289 - (44%) Gaps:59/289 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    47 GVLSNLIPAQRLRR---RITGGRKSSLLSQPWMAFL-HISGDIEMCRCGGSLLSELFVLTAAHCF 107
            |.||...|...::.   |:.||:::|..|.||...| ::|.......|||||::..:|||||||.
  Rat    13 GALSCGYPTYEVQHDVSRVVGGQEASPNSWPWQVSLQYLSSGKWHHTCGGSLVANNWVLTAAHCI 77

  Fly   108 KMCPRSKEIRVWLGELDISSTSDCVTYNYQRVCALPVEEFTIDKWILHEEFNL--FYPGYDIALI 170
            .   .|:..||.||...:|::..         .:|.|:   :.|.::||::|.  ...|.||||:
  Rat    78 S---NSRTYRVLLGRHSLSTSES---------GSLAVQ---VSKLVVHEKWNAQKLSNGNDIALV 127

  Fly   171 KLNKKVVFKDHIRPICLPLTDELLAFTLQLGQSY--MAVGWGRTESRRFANSTME----VHINTE 229
            ||...|.....|:..|||....:|.      .:|  ...||||.::.......::    :.::..
  Rat   128 KLASPVALTSKIQTACLPPAGTILP------NNYPCYVTGWGRLQTNGATPDVLQQGRLLVVDYA 186

  Fly   230 KCTDGR------DTSFLCANGDYV-DTCTGDSGGPL-------IWKTTLFGKARTVQFGVVSTGS 280
            .|:...      .|:.:||.||.| .:|.|||||||       .|:.          .|:||.||
  Rat   187 TCSSASWWGSSVKTNMVCAGGDGVTSSCNGDSGGPLNCQASNGQWQV----------HGIVSFGS 241

  Fly   281 Q-NCGAGQK-AYYMDVPTYVPWILAKMAE 307
            . .|...:| :.:..|..|:.||.:.:|:
  Rat   242 TLGCNYPRKPSVFTRVSNYIDWINSVIAK 270

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG1773NP_610512.1 Tryp_SPc 61..301 CDD:214473 76/264 (29%)
Tryp_SPc 62..301 CDD:238113 75/263 (29%)
Cela2aNP_036685.1 Tryp_SPc 30..264 CDD:214473 76/264 (29%)
Tryp_SPc 31..267 CDD:238113 77/266 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X11
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.