DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG1773 and Prss42

DIOPT Version :9

Sequence 1:NP_610512.1 Gene:CG1773 / 35999 FlyBaseID:FBgn0033439 Length:317 Species:Drosophila melanogaster
Sequence 2:NP_694739.1 Gene:Prss42 / 235628 MGIID:2665280 Length:335 Species:Mus musculus


Alignment Length:319 Identity:87/319 - (27%)
Similarity:140/319 - (43%) Gaps:65/319 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    14 ILCLSCPPS--SQAGREDWTPHELLAYEQLTQQDCGVLSNLIPAQRLRRRITGGRKSSLLSQPWM 76
            :|..|..||  |:|.|::..|...:...:.|.:...:..:|:..|.. .:|.||..:.....||.
Mouse    30 VLSTSGFPSGFSEAPRDNPPPPTRVRMSKATTRSPFMNFSLVCGQPF-MKIMGGVDAEEGKWPWQ 93

  Fly    77 AFLHISGDIEMCRCGGSLLSELFVLTAAHCFKMCPRSK-EIRVWLGELDISSTSDCVTYNYQRVC 140
            ..:.:.   .|..|||||::..:|||||||.    .|: :..|.:|:..:        |......
Mouse    94 VSVRVR---HMHVCGGSLINSQWVLTAAHCI----YSRIQYNVKVGDRSV--------YRQNTSL 143

  Fly   141 ALPVEEFTIDKWILHEEFN-LFYPGYDIALIKLNKKVVFKDHIRPICLPLTDELLAFTLQLGQSY 204
            .:|::  ||   .:|.:|: ......||||:||...|.|..:|.|:|:|..    :|.::.|...
Mouse   144 VIPIK--TI---FVHPKFSTTIVVKNDIALLKLQHPVNFTTNIYPVCIPSE----SFPVKAGTKC 199

  Fly   205 MAVGWGR---------TESRRFANSTMEVHINTEKCTD--GRDTSFLCANGDYV----------- 247
            ...|||:         ||..:..:..:.::   |:|.:  .:.||   ::.|.|           
Mouse   200 WVTGWGKLVPGAPDVPTEILQEVDQNVILY---EECNEMLKKATS---SSVDLVKRGMVCGYKER 258

  Fly   248 --DTCTGDSGGPLIWKTTLFGKARTVQFGVVSTGSQNCG-AGQKAYYMDVPTYVPWILA 303
              |.|.||||||:..:.    :.:.||.||||.|. :|| .|....|.||..|..|::|
Mouse   259 GKDACQGDSGGPMSCEF----ENKWVQVGVVSWGI-SCGRKGYPGVYTDVAFYSKWLIA 312

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG1773NP_610512.1 Tryp_SPc 61..301 CDD:214473 74/266 (28%)
Tryp_SPc 62..301 CDD:238113 74/265 (28%)
Prss42NP_694739.1 Tryp_SPc 78..309 CDD:214473 74/265 (28%)
Tryp_SPc 79..310 CDD:238113 74/265 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.