DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG1773 and Klk1b9

DIOPT Version :9

Sequence 1:NP_610512.1 Gene:CG1773 / 35999 FlyBaseID:FBgn0033439 Length:317 Species:Drosophila melanogaster
Sequence 2:NP_034246.1 Gene:Klk1b9 / 13648 MGIID:95293 Length:261 Species:Mus musculus


Alignment Length:289 Identity:86/289 - (29%)
Similarity:122/289 - (42%) Gaps:71/289 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    49 LSNLIPAQRLRRRITGGRKSSLLSQPWMAFLHISGDIEMCRCGGSLLSELFVLTAAHCFKMCPRS 113
            |..:..|..:..||.||.|....||||...::...:.   .|||.||...:|||||||:     .
Mouse    12 LGGIDAAPPVHSRIVGGFKCEKNSQPWHVAVYRYNEY---ICGGVLLDANWVLTAAHCY-----Y 68

  Fly   114 KEIRVWLGELDISSTSDCVTYNYQRVCALPVEEFTIDKWILHEEFN-------LFYPGY----DI 167
            :|.:|.||:.::........:.            .:.|..||..:|       :.:|.|    |:
Mouse    69 EENKVSLGKNNLYEEEPSAQHR------------LVSKSFLHPGYNRSLHRNHIRHPEYDYSNDL 121

  Fly   168 ALIKLNKKVVFKDHIRPICLPLTDELLAFTLQLGQSYMAVGWGRTESRRFANS------------ 220
            .|::|:|.....|.::||.|| |:|     .:||.:.:|.|||.|...:|.|:            
Mouse   122 MLLRLSKPADITDVVKPIALP-TEE-----PKLGSTCLASGWGSTTPFKFQNAKDLQCVNLKLLP 180

  Fly   221 ---TMEVHINTEKCTDGRDTSFLCANGDY---VDTCTGDSGGPLIWKTTLFGKARTVQFGVVSTG 279
               ..:.||  ||.||    ..||| |:.   .|||.||||||||....|        .|:.|.|
Mouse   181 NEDCGKAHI--EKVTD----VMLCA-GETDGGKDTCKGDSGGPLICDGVL--------QGITSWG 230

  Fly   280 SQNCGAGQK-AYYMDVPTYVPWILAKMAE 307
            ...||..:| ..|..:..:..||...||:
Mouse   231 FTPCGEPKKPGVYTKLIKFTSWIKDTMAK 259

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG1773NP_610512.1 Tryp_SPc 61..301 CDD:214473 80/269 (30%)
Tryp_SPc 62..301 CDD:238113 79/268 (29%)
Klk1b9NP_034246.1 Tryp_SPc 24..253 CDD:214473 80/269 (30%)
Tryp_SPc 25..256 CDD:238113 81/271 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.