DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG1773 and CLIPA4

DIOPT Version :9

Sequence 1:NP_610512.1 Gene:CG1773 / 35999 FlyBaseID:FBgn0033439 Length:317 Species:Drosophila melanogaster
Sequence 2:XP_552464.1 Gene:CLIPA4 / 1280862 VectorBaseID:AGAP011780 Length:422 Species:Anopheles gambiae


Alignment Length:246 Identity:68/246 - (27%)
Similarity:106/246 - (43%) Gaps:36/246 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    74 PWMAFLHISGDIEMCRCGGSLLSELFVLTAAHCFKMCPRSKEIRVWLGELDISSTSDCVTYNYQR 138
            ||...: |........|||||:....|||.|||.:.. |..:::|..||.|..:|.:        
Mosquito   169 PWTVAI-IKTQDGSSTCGGSLIHPNLVLTGAHCVQGF-RKGQLKVRAGEWDTQTTKE-------- 223

  Fly   139 VCALPVEEFTIDKWILHEEFNLFYPGYDIALIKLNKKVVFKDHIRPICLPLTDELLAFTLQLGQS 203
              .||.:|..:.:...|.:||......|||:::|:..:...:||..:|||..:    |..:....
Mosquito   224 --RLPYQERAVTRVNSHPDFNPRSLANDIAVLELDSPIQPAEHINVVCLPPVN----FDTRRTDC 282

  Fly   204 YMAVGWGRTE---SRRFA------------NSTMEVHINTEKCTD--GRDTSFLCANGDY-VDTC 250
            : |.|||:.:   :.|::            :||.|..:...:.|.  ....:|:||.|:. ||||
Mosquito   283 F-ASGWGKDQFGKAGRYSVIMKKVPLPLVPSSTCERQLQATRLTSRFRLHQTFICAGGERGVDTC 346

  Fly   251 TGDSGGPLIWKTTLFGKARTVQFGVVSTGSQNCGAGQKAYYMDVPTYVPWI 301
            .||.|.||:.......:.|..|.|.|:.|. .|.......|.:|..:..||
Mosquito   347 EGDGGAPLVCPIGAASENRYAQVGSVAWGI-GCHDAVPGVYTNVILFRSWI 396

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG1773NP_610512.1 Tryp_SPc 61..301 CDD:214473 66/244 (27%)
Tryp_SPc 62..301 CDD:238113 66/244 (27%)
CLIPA4XP_552464.1 Tryp_SPc 161..399 CDD:238113 68/246 (28%)
Tryp_SPc 161..396 CDD:214473 66/244 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X11
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.