DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG1773 and CG43336

DIOPT Version :9

Sequence 1:NP_610512.1 Gene:CG1773 / 35999 FlyBaseID:FBgn0033439 Length:317 Species:Drosophila melanogaster
Sequence 2:NP_001247122.1 Gene:CG43336 / 12798414 FlyBaseID:FBgn0263041 Length:279 Species:Drosophila melanogaster


Alignment Length:299 Identity:97/299 - (32%)
Similarity:133/299 - (44%) Gaps:70/299 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    35 LLAYEQLTQQDCGVL--SNLIPAQRLRRRITGGRKSSLLSQPWMAFLHISGDIEMCRCGGSLLSE 97
            ||...|.....||:.  |..:|      |:..|..:||.|.||||||| |.|.... |||||::.
  Fly    15 LLGSTQFLDMACGIRAHSPSVP------RVKNGTVASLTSSPWMAFLH-STDGRFI-CGGSLITN 71

  Fly    98 LFVLTAAHCFKMCPRSKEIRVWLGELDISSTSDCVTYNYQRVCALPVEEFTIDKWILHEEFNLFY 162
            ..||||||||  ..|: |:...|||.|......|    :...|...:|.. :::...|..:|...
  Fly    72 RLVLTAAHCF--LDRT-ELVARLGEYDREEYEMC----HDSYCTYRIEAM-VERGFRHRHYNPMT 128

  Fly   163 PGYDIALIKLNKKVVFKDHIRPICLPL-------TDELLAFTLQLGQSYMAVGWGRTES------ 214
            ..||||:::|.:||.:.|:|||||:.:       .|.|...|        ..|||:|||      
  Fly   129 MAYDIAILRLYRKVQYTDNIRPICIVIDPRWRKYIDSLDPLT--------GTGWGKTESEGDSAK 185

  Fly   215 --------------RRFANSTMEVHINTEKCTDGRDTSFLCANGDYVDTCTGDSGGPLIWKTTLF 265
                          ||:|  |:.:..|.           .||..:..:.|.|||||| :.....:
  Fly   186 LRTVDLARKHPEVCRRYA--TLSLTANQ-----------FCAGNERSNLCNGDSGGP-VGALIPY 236

  Fly   266 GKA-RTVQFGVVSTGSQNCGAGQKAYYMDVPTYVPWILA 303
            ||: |.||.|:.|..:..|  ...:.:.||.:||.||||
  Fly   237 GKSKRFVQVGIASFTNTQC--VMVSVFTDVMSYVDWILA 273

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG1773NP_610512.1 Tryp_SPc 61..301 CDD:214473 86/267 (32%)
Tryp_SPc 62..301 CDD:238113 85/266 (32%)
CG43336NP_001247122.1 Tryp_SPc 37..271 CDD:214473 86/267 (32%)
Tryp_SPc 40..271 CDD:238113 85/264 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E33208_3BQ4K
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.