DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG1773 and CG43335

DIOPT Version :9

Sequence 1:NP_610512.1 Gene:CG1773 / 35999 FlyBaseID:FBgn0033439 Length:317 Species:Drosophila melanogaster
Sequence 2:NP_001247121.1 Gene:CG43335 / 12798413 FlyBaseID:FBgn0263040 Length:281 Species:Drosophila melanogaster


Alignment Length:269 Identity:90/269 - (33%)
Similarity:135/269 - (50%) Gaps:26/269 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    40 QLTQQDCGVLSNLIPAQRLRRRITGGRKSSLLSQPWMAFLHISGDIEMCRCGGSLLSELFVLTAA 104
            :|.:.:||:  ..:|:.. |.||.||..:.:.|.||||:|:  .:.... |.|:|::..||||||
  Fly    23 RLLEPNCGI--RTMPSFH-RTRIIGGSDAEITSHPWMAYLY--NEFHYF-CAGTLITNQFVLTAA 81

  Fly   105 HCFKMCPRSKEIRVWLGELDISSTSDCVTYNYQRVCALPVEEFTIDKWILHEEFNLFYPGYDIAL 169
            ||.:   .||.:.|.||       ...:|.:...:|.:..|::::...|.|:.|.......|||:
  Fly    82 HCIE---ASKNLTVRLG-------GSGLTRSDGSMCQITAEDYSVSMAIKHKYFTPSIMLNDIAM 136

  Fly   170 IKLNKKVVFKDHIRPICLPLTDELLAFTLQLGQSYMAVGWGRTESRRFANSTMEVHI---NTEKC 231
            |:|.:.|.|.|||||||: :.|..:...|:.|.:.||.|||..:.|...:...|..|   |...|
  Fly   137 IRLARTVKFYDHIRPICI-ILDPAVRLLLEDGMTLMATGWGLADKRMHPHLLQEAPITVMNRNVC 200

  Fly   232 TDGRDTSF----LCANGDYVDTCTGDSGGPLIWKTTLFGKARTVQFGVVSTGSQNCGAGQKAYYM 292
            :...|.:.    :||.....:||.|||||||......:|..|.||:|:.|.|...|.:  .:.|.
  Fly   201 SKLYDVAITQGQICAGDKETNTCLGDSGGPLGGVVNYYGDLRFVQYGITSFGDIECRS--PSIYT 263

  Fly   293 DVPTYVPWI 301
            |:.||..||
  Fly   264 DLSTYSGWI 272

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG1773NP_610512.1 Tryp_SPc 61..301 CDD:214473 83/246 (34%)
Tryp_SPc 62..301 CDD:238113 82/245 (33%)
CG43335NP_001247121.1 Tryp_SPc 41..272 CDD:214473 83/246 (34%)
Tryp_SPc 42..275 CDD:238113 84/247 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E33208_3BQ4K
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.