DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG1773 and CG43125

DIOPT Version :9

Sequence 1:NP_610512.1 Gene:CG1773 / 35999 FlyBaseID:FBgn0033439 Length:317 Species:Drosophila melanogaster
Sequence 2:NP_001247344.1 Gene:CG43125 / 12798281 FlyBaseID:FBgn0262588 Length:258 Species:Drosophila melanogaster


Alignment Length:321 Identity:74/321 - (23%)
Similarity:117/321 - (36%) Gaps:121/321 - (37%)


- Green bases have known domain annotations that are detailed below.


  Fly    35 LLAYE---QLTQQDCGVLSNLIPAQRLRRRITGGRKSSLLS-QPWMAFL--HISGDIEMCRCGGS 93
            ||.|:   ...:|:||                   |||:.| .||:..:  .:|.:|   .|.|:
  Fly    13 LLFYQGSALFLEQNCG-------------------KSSVFSPAPWLVKIRPELSSNI---TCTGT 55

  Fly    94 LLSELFVLTAAHCFKMCPRSKEIRVWLGELDISSTSDCVTYNYQRVCALPVEEFTIDKWILHEEF 158
            |::|.||||||.|...   ..|:.|.|||:|         ...|....|..||..:.:.::|..:
  Fly    56 LINERFVLTAASCIDY---QTELIVRLGEID---------GTLQNSSKLQYEEIYVARALIHRSY 108

  Fly   159 NLFYPGYDIALIKLNKKVVFKDHIRPICLPL----TDELLAFTLQLGQSYMAVGWGRTESRRFAN 219
            :.....|:|||::|...||:|.:|:|||:.:    ..:...|.::..::        .|.::...
  Fly   109 SSESHQYNIALLRLKTSVVYKKNIQPICIDVNVGKVPKAPTFEIEKKKN--------EEPKKNKA 165

  Fly   220 STMEVHINTEKCTDGRDTSFLCANGDYVDTCTGDSGGPLIWKTTLFG------------------ 266
            ..|:..:|                                |..:|||                  
  Fly   166 GIMKRFLN--------------------------------WFLSLFGVREPRPDVILPPQPIAVG 198

  Fly   267 ---------KARTVQFGVVSTGSQNCGAGQKAYYMDVPTYVPWI--LA-----KMAELSDF 311
                     .|...|:|::|..:..   .:|..|.||..||.||  ||     .||..:||
  Fly   199 WPLTKQINESALFHQYGILSHRNSE---SKKDVYTDVMAYVNWITPLALDVHITMAPNTDF 256

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG1773NP_610512.1 Tryp_SPc 61..301 CDD:214473 60/273 (22%)
Tryp_SPc 62..301 CDD:238113 60/272 (22%)
CG43125NP_001247344.1 Tryp_SPc 37..>137 CDD:304450 37/114 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.