DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG1773 and SCRASP1

DIOPT Version :9

Sequence 1:NP_610512.1 Gene:CG1773 / 35999 FlyBaseID:FBgn0033439 Length:317 Species:Drosophila melanogaster
Sequence 2:XP_315638.3 Gene:SCRASP1 / 1276311 VectorBaseID:AGAP005625 Length:1322 Species:Anopheles gambiae


Alignment Length:337 Identity:92/337 - (27%)
Similarity:146/337 - (43%) Gaps:71/337 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    13 GILC-LSCPPSSQAGREDWT-PHELLAYEQLTQQ----DCGVLSNLIPAQRLRR-----RITGGR 66
            |:.| :..|..::|.|...| |:....:.:.:::    .||   .::....||:     |:..|.
Mosquito  1022 GVRCGVYVPTKARAARLRATRPNPRFDFVERSRKIHPDTCG---RVLIDPTLRKPTYGARVVHGS 1083

  Fly    67 KSSLLSQPWMAFLHISGDIEMCRCGGSLLSELFVLTAAHCFKMCPRSKEIRVWLGELDISSTSDC 131
            ::.....||.|.|.:.   .|..||..|::...|||||||....|:| ..||.:|:...::    
Mosquito  1084 ETVYGHHPWQASLRVK---TMHWCGAVLITRYHVLTAAHCLIGYPKS-TYRVRIGDYHTAA---- 1140

  Fly   132 VTYNYQRVCALPVEEFTIDKWILHEEFNLFYPGY----DIALIKLNKKVVFKDHIRPICLPLTDE 192
              |:...:      :..|:...:||:|.   .|:    |||::.|...|.|.|:::|||||..|.
Mosquito  1141 --YDNAEL------DIFIENTYIHEQFR---EGHHMSNDIAVVVLKTPVRFNDYVQPICLPARDA 1194

  Fly   193 LLAFTLQLGQSYMAVGWGRTESRRFANSTMEVHINT------------EKCTDGRDTSFLCAN-- 243
                ....||:....|||.||:.. .:|:.::...|            |...|.......||.  
Mosquito  1195 ----PYLPGQNCTISGWGATEAGS-KDSSYDLRAGTVPLLPDSVCRRPEVYGDSLIDGMFCAGTL 1254

  Fly   244 --GDYVDTCTGDSGGPLIWKTTLFGKARTVQFGVVSTGSQNCG-AGQKAYYMDVPTYVPWILAKM 305
              |  ||:|.|||||||:...:   :......|:||.| ::|| |.:...|:.|..|..||..|:
Mosquito  1255 EPG--VDSCDGDSGGPLVCPNS---EGLHTLTGIVSWG-KHCGYANKPGVYLKVAHYRDWIEQKL 1313

  Fly   306 AELSDFKGSLHR 317
            .:      |||:
Mosquito  1314 NQ------SLHQ 1319

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG1773NP_610512.1 Tryp_SPc 61..301 CDD:214473 75/260 (29%)
Tryp_SPc 62..301 CDD:238113 74/259 (29%)
SCRASP1XP_315638.3 ChtBD2 181..228 CDD:214696
ChtBD2 289..334 CDD:214696
LDLa 731..762 CDD:238060
SRCR 776..878 CDD:278931
SR 776..877 CDD:214555
LDLa 884..921 CDD:238060
SR 927..1025 CDD:214555 1/2 (50%)
SRCR 932..1025 CDD:278931 1/2 (50%)
Tryp_SPc 1078..1309 CDD:214473 75/260 (29%)
Tryp_SPc 1079..1312 CDD:238113 76/262 (29%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.