DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG1773 and LOC116408674

DIOPT Version :9

Sequence 1:NP_610512.1 Gene:CG1773 / 35999 FlyBaseID:FBgn0033439 Length:317 Species:Drosophila melanogaster
Sequence 2:XP_031752209.1 Gene:LOC116408674 / 116408674 -ID:- Length:392 Species:Xenopus tropicalis


Alignment Length:232 Identity:66/232 - (28%)
Similarity:108/232 - (46%) Gaps:38/232 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    90 CGGSLLSELFVLTAAHCFKMCPRSKEIRVWLGELDISSTSDCVTYNYQRVCALPVEEFTIDKWIL 154
            |.|::|:..::.||||||:......:|:    .|.:...:..::...:.:..|.|::.     |.
 Frog     8 CTGTVLNNQWIFTAAHCFRHLNGENDIK----SLQVVLGAHLLSEKEKHIQVLNVKQI-----IQ 63

  Fly   155 HEEFNLFYPGYDIALIKLNKKVVFKDHIRPICLPLTDELLAFTLQLGQSYMAVGWG-RTESRRFA 218
            ||.::.....||||||:|||.|...|:::|.|||::...|.   .|.:.|:| ||| |.|.....
 Frog    64 HELYDPKVQYYDIALIQLNKPVQLNDYVQPACLPMSSATLE---PLTECYLA-GWGVRDEGDEPV 124

  Fly   219 NSTMEV---HINTEKCTDGRDTSFLCANGDY---------VDTCTGDSGGPLIWKTTLFGKARTV 271
            ....||   .||:::|    :.::|.|..:|         :.:|.|||..||:.|.    |..|:
 Frog   125 AIMQEVKVERINSKRC----NKTYLGAIQEYHLCASQKANMKSCQGDSAAPLMCKR----KTSTI 181

  Fly   272 QFGVVSTGSQNCGAGQ---KAYYMDVPTYVPWILAKM 305
             |.|:...|...|..|   ...|.....:|.|::.|:
 Frog   182 -FSVIGIASWGSGCSQINSPGIYTSTKDFVKWMVEKV 217

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG1773NP_610512.1 Tryp_SPc 61..301 CDD:214473 64/226 (28%)
Tryp_SPc 62..301 CDD:238113 64/226 (28%)
LOC116408674XP_031752209.1 Tryp_SPc 2..212 CDD:238113 64/225 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.