DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG1773 and Try5

DIOPT Version :9

Sequence 1:NP_610512.1 Gene:CG1773 / 35999 FlyBaseID:FBgn0033439 Length:317 Species:Drosophila melanogaster
Sequence 2:NP_001003405.1 Gene:Try5 / 103964 MGIID:102756 Length:246 Species:Mus musculus


Alignment Length:261 Identity:73/261 - (27%)
Similarity:104/261 - (39%) Gaps:64/261 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    61 RITGG---RKSSLLSQPWMAFLHISGDIEMCRCGGSLLSELFVLTAAHCFKMCPRSKEIRVWLGE 122
            :|.||   |::|:   |:...|:.....    |||||:::.:|::||||:|     ..|:|.|||
Mouse    23 KIVGGYTCRENSI---PYQVSLNSGYHF----CGGSLINDQWVVSAAHCYK-----TRIQVRLGE 75

  Fly   123 LDISSTSDCVTYNYQRVCALPVEEFTIDKWILHEEFNLFYPGYDIALIKLNKKVVFKDHIRPICL 187
            .:|    :.:..|.|.|.:.        |.|.|..||......||.||||...|.....:..:.|
Mouse    76 HNI----NVLEGNEQFVNSA--------KIIKHPNFNSRTLNNDIMLIKLASPVTLNARVATVAL 128

  Fly   188 PLTDELLAFTLQLGQSYMAVGWGRTESRRFANSTMEVHINTEKCTD--------------GRDTS 238
            |      :.....|...:..|||.|.|....|..:      .:|.|              |:.|:
Mouse   129 P------SSCAPAGTQCLISGWGNTLSFGVNNPDL------LQCLDAPLLPQADCEASYPGKITN 181

  Fly   239 FLCANG---DYVDTCTGDSGGPLIWKTTLFGKARTVQFGVVSTGSQNCGAGQKAYYMDVPTYVPW 300
            .:...|   ...|:|.||||||::....|.|   .|.:|.......|.|.     |..|..||.|
Mouse   182 NMICVGFLEGGKDSCQGDSGGPVVCNGQLQG---IVSWGYGCALKDNPGV-----YTKVCNYVDW 238

  Fly   301 I 301
            |
Mouse   239 I 239

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG1773NP_610512.1 Tryp_SPc 61..301 CDD:214473 71/259 (27%)
Tryp_SPc 62..301 CDD:238113 71/258 (28%)
Try5NP_001003405.1 Tryp_SPc 23..239 CDD:214473 71/259 (27%)
Tryp_SPc 24..242 CDD:238113 73/260 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.