DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG1773 and LOC101732176

DIOPT Version :9

Sequence 1:NP_610512.1 Gene:CG1773 / 35999 FlyBaseID:FBgn0033439 Length:317 Species:Drosophila melanogaster
Sequence 2:XP_031752403.1 Gene:LOC101732176 / 101732176 -ID:- Length:516 Species:Xenopus tropicalis


Alignment Length:285 Identity:74/285 - (25%)
Similarity:121/285 - (42%) Gaps:63/285 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    45 DCGVLSNLIPAQRLRRRITGGRKSSLLSQPWMAFLHISGDIEMCRCGGSLLSELFVLTAAHCFKM 109
            :||:      :.::..||.||..:.....||...|.......:..||||:::..:::|||||...
 Frog   266 NCGL------STKVDNRIVGGTFALAGDWPWQISLMKLVGTSLYLCGGSIITPYWIVTAAHCVYG 324

  Fly   110 CPRSKEI-RVWLGELDISSTSDCVTYNYQRVCALPVEEFTIDKWILHEEFNLFYPGYDIALIKLN 173
            ...|..| :|:.|.|.:|        ||...      .:.:|:.::|..::.....|||||:||.
 Frog   325 YTSSPSIFKVFAGSLTLS--------NYYSA------GYLVDRVLIHPSYSPNTQNYDIALLKLK 375

  Fly   174 KKVVFKDHIRPICLPLTDELLAFTLQLGQSYMAVGWGRTESRRFANSTMEVH----INTEKCTDG 234
            ..:||..::||:|||    .:......||.....|||.|......:::::..    |::..|...
 Frog   376 TALVFSTNLRPVCLP----NVGMPWADGQPCWISGWGTTSEAGSISTSLKAASVPIISSATCNLA 436

  Fly   235 R------DTSFLCAN--GDYVDTCTGDSGGPLIWKTTL-----------FGKARTVQFGVVSTGS 280
            .      ..:.:||.  |...|||.|||||||:.||..           :|.||..:.||     
 Frog   437 PVYGGVISPTMICAGYLGGGTDTCQGDSGGPLVTKTNSLWWLVGDTSWGYGCARAYKPGV----- 496

  Fly   281 QNCGAGQKAYYMDVPTYVPWILAKM 305
                      |.::..::.||.::|
 Frog   497 ----------YGNITVFLEWIYSQM 511

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG1773NP_610512.1 Tryp_SPc 61..301 CDD:214473 69/263 (26%)
Tryp_SPc 62..301 CDD:238113 68/262 (26%)
LOC101732176XP_031752403.1 LDLa <115..133 CDD:238060
LDLa 140..171 CDD:238060
SRCR_2 176..271 CDD:406055 2/10 (20%)
Tryp_SPc 277..510 CDD:238113 70/265 (26%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.