DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG1773 and LOC100495222

DIOPT Version :9

Sequence 1:NP_610512.1 Gene:CG1773 / 35999 FlyBaseID:FBgn0033439 Length:317 Species:Drosophila melanogaster
Sequence 2:XP_031749236.1 Gene:LOC100495222 / 100495222 -ID:- Length:755 Species:Xenopus tropicalis


Alignment Length:334 Identity:91/334 - (27%)
Similarity:129/334 - (38%) Gaps:88/334 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly    11 IWGILCLSCPPSSQAGREDWTPHELLAYEQLTQQDCG--VLSNLIPAQRLRRRITGGRKSSLLSQ 73
            :.|:|.|..|.:||       |..:.|...|    ||  |.|:         ||.||..:...:.
 Frog     8 VMGLLLLVSPNTSQ-------PSIITAAPPL----CGNPVFSS---------RIVGGTDTRQGAW 52

  Fly    74 PWMAFLHISGDIEMCRCGGSLLSELFVLTAAHCFKMCPRSKEIRVWLGELDISSTSDCVTYNYQR 138
            ||...|..:|.   ..||||::|:.::||||||.:.........|.||.             ||.
 Frog    53 PWQISLEFNGS---HICGGSIVSDQWILTAAHCIEHPDMPSGYGVRLGA-------------YQL 101

  Fly   139 VCALPVEEFTIDKWILHEEFNLFYPGY--DIALIKLNKKVVFKDHIRPICLPLTDELLAFTLQLG 201
            ....| .|.||....::.......||.  ||||:||:..:.:.::|.|||:|..    ..|...|
 Frog   102 YVKNP-HEITIKVTAIYVNSQFDGPGASGDIALLKLSSPIKYTEYILPICMPTA----TATFPPG 161

  Fly   202 QSYMAVGWGRT---ESRRFANSTMEVH---INTEKCTDGRDTSFLCANGDYV------------- 247
            ......|||..   .|.::..:..:|.   |..:.|......:.:.:|.:.:             
 Frog   162 TQCWVTGWGEIGSGVSLQYPATLQKVMVPLIGRDVCDKMYHINSIISNSEVLIQNDQICAGYQVG 226

  Fly   248 --DTCTGDSGGPL------IWKTTLFGKARTVQFGVVSTGSQNCGA-GQKAYYMDVPTYVPWILA 303
              |.|.|||||||      ||          .|.|:||.| :.|.| .:...|..||.|..||.|
 Frog   227 QKDGCQGDSGGPLVCQIQGIW----------YQAGIVSWG-EGCAAKNRPGVYTFVPAYESWISA 280

  Fly   304 KMAELSDFK 312
            :    ||.:
 Frog   281 R----SDIR 285

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG1773NP_610512.1 Tryp_SPc 61..301 CDD:214473 73/269 (27%)
Tryp_SPc 62..301 CDD:238113 72/268 (27%)
LOC100495222XP_031749236.1 Tryp_SPc 41..279 CDD:238113 73/269 (27%)
Tryp_SPc 431..670 CDD:238113
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X11
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.