DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Uba1 and UBA5

DIOPT Version :9

Sequence 1:NP_477310.2 Gene:Uba1 / 35998 FlyBaseID:FBgn0023143 Length:1191 Species:Drosophila melanogaster
Sequence 2:NP_079094.1 Gene:UBA5 / 79876 HGNCID:23230 Length:404 Species:Homo sapiens


Alignment Length:430 Identity:90/430 - (20%)
Similarity:170/430 - (39%) Gaps:141/430 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly   575 VEEADAQPVGSR-YDSQIAIFGKKF-----QEKLADSKWFIVGAGAIG---CELLKNFGMLGLGT 630
            :|:..::.|.|. |...:|:  |:.     .||:......|||.|.:|   .|:|...|:     
Human    40 IEKMSSEVVDSNPYSRLMAL--KRMGIVSDYEKIRTFAVAIVGVGGVGSVTAEMLTRCGI----- 97

  Fly   631 GNGQIFVTDMDLIEKSNLNRQFLFRPHDVQKPKSMTAADAIKRMNPEV-------NVTAYEL--- 685
              |::.:.|.|.:|.:|:||.| |:||.....|...|...::.:||:|       |:|..|.   
Human    98 --GKLLLFDYDKVELANMNRLF-FQPHQAGLSKVQAAEHTLRNINPDVLFEVHNYNITTVENFQH 159

  Fly   686 ---RV---GAETEKVFSEDFFGKLDGVANALDNVDARIYMDRKCIFNRI--PLVETGTL--GTLG 740
               |:   |.|..|        .:|.|.:.:||.:||:.::..|  |.:  ..:|:|..  ...|
Human   160 FMDRISNGGLEEGK--------PVDLVLSCVDNFEARMTINTAC--NELGQTWMESGVSENAVSG 214

  Fly   741 NVQVIVPFATESYSSSQDPP--------EKSIP---ICTLKNFPNA--------IEHTLQWARDA 786
            ::|:|:|..:..::.:  ||        ||::.   :|. .:.|..        :::.|::..: 
Human   215 HIQLIIPGESACFACA--PPLVVAANIDEKTLKREGVCA-ASLPTTMGVVAGILVQNVLKFLLN- 275

  Fly   787 FEGVFKQSAENAAQYI-------ADPQ------------FTERIAKLPGIQPLEILDSIKKALID 832
            |..|......||.|..       .:||            :.:::|.||   ..|::...::.:.:
Human   276 FGTVSFYLGYNAMQDFFPTMSMKPNPQCDDRNCRKQQEEYKKKVAALP---KQEVIQEEEEIIHE 337

  Fly   833 DKPKSFAHCVEWARLYWEDQYVNQI-KQLLFNFP------PDQITSSGQPFWSGPKRCPDPLVFD 890
            |..             |..:.|::: ::.|.||.      |:.||.:    ::.||:..|     
Human   338 DNE-------------WGIELVSEVSEEELKNFSGPVPDLPEGITVA----YTIPKKQED----- 380

  Fly   891 VNDPMHLDFIYAAANLRAEVYGIEQVRNRETIAELVQKVK 930
                       :...|..|..|       |::.:|:.|:|
Human   381 -----------SVTELTVEDSG-------ESLEDLMAKMK 402

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Uba1NP_477310.2 Ube1 194..1188 CDD:273603 90/430 (21%)
Ube1_repeat1 199..574 CDD:238768
E1_4HB 447..510 CDD:292809
Ube1_repeat2 606..1144 CDD:238767 82/393 (21%)
UBA5NP_079094.1 ThiF_MoeB_HesA_family 52..297 CDD:238386 62/268 (23%)
UFM1-interacting sequence (UIS). /evidence=ECO:0000269|PubMed:26929408, ECO:0000269|PubMed:27653677 334..346 2/24 (8%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0476
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.