DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Uba1 and Atg7

DIOPT Version :9

Sequence 1:NP_477310.2 Gene:Uba1 / 35998 FlyBaseID:FBgn0023143 Length:1191 Species:Drosophila melanogaster
Sequence 2:NP_001240646.1 Gene:Atg7 / 74244 MGIID:1921494 Length:741 Species:Mus musculus


Alignment Length:91 Identity:25/91 - (27%)
Similarity:45/91 - (49%) Gaps:7/91 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly   600 EKLADSKWFIVGAGAIGCELLKNFGMLGLGTGNGQIFVTDMDLIEKSNLNRQFLFRPHDV---QK 661
            :|:...|..::|||.:||.:.:..    :|.|...:...|...|..||..||.|:...|.   .|
Mouse   390 DKVVSVKCLLLGAGTLGCNVARTL----MGWGVRHVTFVDNAKISYSNPVRQPLYEFEDCLGGGK 450

  Fly   662 PKSMTAADAIKRMNPEVNVTAYELRV 687
            ||::.||:.::::.|.||...:.:.:
Mouse   451 PKALAAAERLQKIFPGVNARGFNMSI 476

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Uba1NP_477310.2 Ube1 194..1188 CDD:273603 25/91 (27%)
Ube1_repeat1 199..574 CDD:238768
E1_4HB 447..510 CDD:292809
Ube1_repeat2 606..1144 CDD:238767 24/85 (28%)
Atg7NP_001240646.1 ATG7_N 52..359 CDD:293029
E1_like_apg7 54..740 CDD:273590 25/91 (27%)
Apg7 396..720 CDD:238763 24/85 (28%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0476
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.