DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Uba1 and Mocs3

DIOPT Version :9

Sequence 1:NP_477310.2 Gene:Uba1 / 35998 FlyBaseID:FBgn0023143 Length:1191 Species:Drosophila melanogaster
Sequence 2:NP_001153802.1 Gene:Mocs3 / 69372 MGIID:1916622 Length:460 Species:Mus musculus


Alignment Length:220 Identity:64/220 - (29%)
Similarity:99/220 - (45%) Gaps:14/220 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly   586 RYDSQIAI--FGKKFQEKLADSKWFIVGAGAIGCELLKNFGMLGLGTGNGQIFVTDMDLIEKSNL 648
            ||..|:.:  .|.:.|.:||.:...:||.|.:||.|.:.....|:    |::.:.|.|::|.|||
Mouse    62 RYSRQLLLPELGVRGQLRLAAAAVLVVGCGGLGCPLAQYLAAAGV----GRLGLVDHDVVETSNL 122

  Fly   649 NRQFLFRPHDVQKPKSMTAADAIKRMNPEVNVTAYELRVGAETEKVFSEDFFGKLDGVANALDNV 713
            .||.|.......:.|:.:||.|::|:|..|...||. |..||.   ::.|.....|.||:..|||
Mouse   123 ARQVLHGEAQAGESKARSAAAALRRLNSAVECVAYP-RALAED---WALDLVRGYDVVADCCDNV 183

  Fly   714 DARIYMDRKCIFNRIPLVETGTLGTLGNVQVIVPFATESYSS--SQDPPEKSIPICTLKNFPNAI 776
            ..|..::..|:....|||....|...|.:.|........|..  .:.||.:::..|.......|:
Mouse   184 PTRYLVNDACVLAGRPLVSASALRFEGQMTVYHHDGGPCYRCVFPRPPPPETVTNCADGGVLGAV 248

  Fly   777 EHTLQWARDAFEGVFKQSAENAAQY 801
            ...|..|: |.| |.|.:|...:.|
Mouse   249 PGVLGCAQ-ALE-VLKIAAGLGSSY 271

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Uba1NP_477310.2 Ube1 194..1188 CDD:273603 64/220 (29%)
Ube1_repeat1 199..574 CDD:238768
E1_4HB 447..510 CDD:292809
Ube1_repeat2 606..1144 CDD:238767 57/198 (29%)
Mocs3NP_001153802.1 PRK07411 56..460 CDD:180967 64/220 (29%)
ThiF_MoeB_HesA_family 62..285 CDD:238386 64/220 (29%)
RHOD_ThiF 327..460 CDD:238784
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0476
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.