DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Uba1 and Sae1

DIOPT Version :9

Sequence 1:NP_477310.2 Gene:Uba1 / 35998 FlyBaseID:FBgn0023143 Length:1191 Species:Drosophila melanogaster
Sequence 2:NP_001272820.1 Gene:Sae1 / 56459 MGIID:1929264 Length:350 Species:Mus musculus


Alignment Length:430 Identity:107/430 - (24%)
Similarity:155/430 - (36%) Gaps:145/430 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly   192 GGDIDE---SLYSRQLYVLGHDAMRRMANSDILLSGLGGLGLEIAKNVILGGVKSITLHDTATCG 253
            ||.|.|   :.|.||:.:.|.:|.:|:..|.:|:.|:.|||.|||||:||.|||.:|:.|.....
Mouse    12 GGGISEEEAAQYDRQIRLWGLEAQKRLRASRVLIVGMKGLGAEIAKNLILAGVKGLTMLDHEQVS 76

  Fly   254 LHDLSSQFYLTEADIGKNRAEASCAQLAELNNYVRTVSHTGPL---TEEFLRKFRVVVLTNSDGE 315
            ..|..:||.:....:|:||||||..:...||..|.....|..:   .|.|..||..|.||....:
Mouse    77 PEDPGAQFLIQTGSVGRNRAEASLERAQNLNPMVDVKVDTEDVEKKPESFFTKFDAVCLTCCSRD 141

  Fly   316 EQQRIAKFAHENGIALIIAETRGLFAKVFCDFGESFTIYDQDGTQPISTMIASITHDAQGVVTCL 380
            ...::.:..|.|.|.....:..|.....|.:.||...:.::       |.:|.:   :|||    
Mouse   142 VIIKVDQICHRNSIKFFTGDVFGYHGYTFANLGEHEFVEEK-------TKVAKV---SQGV---- 192

  Fly   381 DETRHGFNDGDYVTFSEVQGMQELNGCQPLKITVLGPYTFSIGDTSKFGEYKSGGVATQVKMPKT 445
                   .||                                                       
Mouse   193 -------EDG------------------------------------------------------- 195

  Fly   446 ISFKPLAQATEEPEFLISDFAKLDSPATLHVAFNALSCYRKAHNGALPRPWNEEDANS------- 503
                        ||   :..|||||..|..|....|.|..|.   ||...|:.|.|.:       
Mouse   196 ------------PE---AKRAKLDSSETTMVKKKVLFCPVKE---ALEVDWSGEKAKAALKRTAP 242

  Fly   504 ---FLEVV----------RASSNAEVDEKLVLQ-------------------FAKICSGNTCPLD 536
               .|:|:          ..|.:.:.|.:|:||                   |.:.|.....|:.
Mouse   243 DYFLLQVLLKFRTDKGRDPTSESYKEDAELLLQIRNDVFDSLGISPDLLPDDFVRYCFSEMAPVC 307

  Fly   537 AAVGGIVAQEVLKACSGKFTPIYQWLYFDAL------ECL 570
            |.||||:|||::||.|.:..|...:.:||.:      |||
Mouse   308 AVVGGILAQEIVKALSQRDPPHNNFFFFDGMKGSGIVECL 347

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Uba1NP_477310.2 Ube1 194..1188 CDD:273603 105/428 (25%)
Ube1_repeat1 199..574 CDD:238768 103/420 (25%)
E1_4HB 447..510 CDD:292809 19/82 (23%)
Ube1_repeat2 606..1144 CDD:238767
Sae1NP_001272820.1 Aos1_SUMO 20..345 CDD:238769 100/418 (24%)
ThiF 23..338 CDD:279270 100/408 (25%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0476
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.