DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Uba1 and Uba3

DIOPT Version :9

Sequence 1:NP_477310.2 Gene:Uba1 / 35998 FlyBaseID:FBgn0023143 Length:1191 Species:Drosophila melanogaster
Sequence 2:NP_610913.1 Gene:Uba3 / 36539 FlyBaseID:FBgn0263697 Length:450 Species:Drosophila melanogaster


Alignment Length:489 Identity:122/489 - (24%)
Similarity:175/489 - (35%) Gaps:188/489 - (38%)


- Green bases have known domain annotations that are detailed below.


  Fly   609 IVGAGAIGCELLKNFGMLGLGTGNGQIFVTDMDLIEKSNLNRQFLFRPHDVQKPKSMTAADAIKR 673
            |:|||.:||||||:..::|.    |.:.|.|||.||.||||||||||..|:...|:..||..|..
  Fly    53 IIGAGGLGCELLKDLALMGF----GNLHVIDMDTIELSNLNRQFLFRRTDIGASKAECAARFINA 113

  Fly   674 MNPEVNVTAYELRVGAETEKVFSEDFFGKLDGVANALDNVDARIY----------------MDRK 722
            ..|...||.:..::     :.|.|.|:.:...|...||::.||.:                :|..
  Fly   114 RVPTCRVTPHFKKI-----QDFDESFYQQFHLVVCGLDSIVARRWINGMLLSMLRYEEDGTIDTS 173

  Fly   723 CIFNRIPLVETGTLGTLGNVQVIVPFATESYSSSQD--PPEKSIPICTLKNFPNAIEHTLQWARD 785
            .|   :|:::.||.|..||.:||:|..|.....:.|  ||:.:.|:||:.|.|            
  Fly   174 SI---VPMIDGGTEGFKGNARVILPGFTACIECTLDLFPPQVNYPLCTIANTP------------ 223

  Fly   786 AFEGVFKQSAENAAQYIADPQFTERIAKLPGIQPLEILDSIKKALIDDKPKSFAHCVEWAR-LYW 849
                                       :||                       .||:|:.: :.|
  Fly   224 ---------------------------RLP-----------------------EHCIEYVKIIQW 238

  Fly   850 EDQYVNQIKQLLFNFPPDQITSSGQPFWSGPKRCPDPLVFDVNDPMHLDFIYAAANLRAEVYGIE 914
            |       ||..|..|                       .|.:||.|:.:||..|..|:..:.|.
  Fly   239 E-------KQNPFGVP-----------------------LDGDDPQHIGWIYERALERSNEFNIT 273

  Fly   915 QVRNRETIAELVQKVKVPEFKPRSGVKIETNEAAAAASA-----------------NNFDDGELD 962
            .|..|     |||.| |....|   ....||.|.|||.|                 .||:|    
  Fly   274 GVTYR-----LVQGV-VKHIIP---AVASTNAAIAAACALEVFKLATSCYDSMANYLNFND---- 325

  Fly   963 QDRVDKIISELLKNADKSSKI-------TPLEFEKDDDSNLHMDFIVACSNLRAANYKIPPADRH 1020
               :|.|.:...: |:||...       .||..|..:.:.|.....:.|.:         |..:.
  Fly   326 ---LDGIYTYTYE-AEKSENCLACSNTPQPLPIEDPNTTTLEDVIKLLCDS---------PRFQL 377

  Fly  1021 KSKLIAGKIIPAIATT-------TSVLSGLAVLE 1047
            ||        ||:.|.       |..:||:..:|
  Fly   378 KS--------PALTTVMKDGKRRTLYMSGVKSIE 403

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Uba1NP_477310.2 Ube1 194..1188 CDD:273603 122/489 (25%)
Ube1_repeat1 199..574 CDD:238768
E1_4HB 447..510 CDD:292809
Ube1_repeat2 606..1144 CDD:238767 122/489 (25%)
Uba3NP_610913.1 ThiF 48..>220 CDD:279270 62/178 (35%)
Uba3_RUB 50..346 CDD:238765 107/413 (26%)
E2_bind 357..442 CDD:285976 12/64 (19%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45446858
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0476
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR10953
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.840

Return to query results.
Submit another query.