DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Uba1 and Uba4

DIOPT Version :9

Sequence 1:NP_477310.2 Gene:Uba1 / 35998 FlyBaseID:FBgn0023143 Length:1191 Species:Drosophila melanogaster
Sequence 2:NP_001260255.1 Gene:Uba4 / 34187 FlyBaseID:FBgn0032054 Length:453 Species:Drosophila melanogaster


Alignment Length:466 Identity:90/466 - (19%)
Similarity:145/466 - (31%) Gaps:148/466 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly   585 SRYDSQIAI--FGKKFQEKLADSKWFIVGAGAIGCELLKNFGMLGLGTGNGQIFVTDMDLIEKSN 647
            :||..|:.:  ||.:.|.||.:|...|||.|.:||...:...    ..|.|.:.:.|.|.:|:||
  Fly    70 ARYSRQLILPDFGVQGQLKLKNSSVLIVGLGGLGCPAAQYLA----AAGCGHLGLVDYDEVERSN 130

  Fly   648 LNRQFLFRPHDVQKPKSMTAADAIKRMNPEVNVTAYELRVGAETEKVFSEDFFGKLDGVANALDN 712
            .:||.|.........|:.:|..|:..:||...:..:...:...........:    |.|.:..||
  Fly   131 FHRQILHSEDRCGMSKAESARIALLELNPHCEIQCHSRMLYPHNAMHIIRGY----DVVLDCTDN 191

  Fly   713 VDARIYMDRKCIFNRIPLVETGTLGTLGNVQVIVPFATESYSSSQ--------DPPEKSIPICTL 769
            |..|..:...|:....|||....|...|.:.|.      :|::..        .||.:::..|..
  Fly   192 VPTRYLLSDACVMLSKPLVSGSALKMDGQLTVY------NYANGPCYRCIFPVPPPPEAVTNCGD 250

  Fly   770 KNFPNAIEHTLQWARDAFE-----------------------GVF-----KQSAENAAQYIADPQ 806
            .....|:..|: .|..|.|                       |||     :....|.....|.|.
  Fly   251 GGVLGAVTGTI-GAMQALEAIKVIVGMGDVLAGRLLIFDGGSGVFRNIRIRSKRPNCHMCSAQPL 314

  Fly   807 FTERI--AKLPGI------QPLEILDSIKKALIDDKPKSFAHCVEWARLYWEDQYVNQIKQLLFN 863
            .||.|  ....|:      .|:.:|.:.::..::|                   |..:|:     
  Fly   315 ITELINYEMFCGMHATDKNNPMLLLSTDERLSVED-------------------YQQKIQ----- 355

  Fly   864 FPPDQITSSGQPFWSGPKRCPDPLVFDVNDPMHLDFIYAAANLRAEVYGIEQVRNRETIAELVQK 928
                     .||.          |:.||......:                       |.:|.:.
  Fly   356 ---------AQPH----------LLIDVRPTAEFE-----------------------ICQLPEA 378

  Fly   929 VKVP-------EFKPRSGVKIETNEAAAAASANNFDDGELDQDRVDKIISELLKNADKSSKITPL 986
            |.||       .:..|.|.::|..|..........:|.:        |..:.|:|.      .|.
  Fly   379 VNVPLVEILDDSYLKRLGKQLEDKELPIVLVCRRGNDSQ--------IAVQHLRNR------FPT 429

  Fly   987 EFEKDDDSNLH 997
            .|.:|....||
  Fly   430 HFVRDLIGGLH 440

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Uba1NP_477310.2 Ube1 194..1188 CDD:273603 90/466 (19%)
Ube1_repeat1 199..574 CDD:238768
E1_4HB 447..510 CDD:292809
Ube1_repeat2 606..1144 CDD:238767 81/443 (18%)
Uba4NP_001260255.1 PRK07878 56..453 CDD:181156 90/466 (19%)
ThiF_MoeB_HesA_family 71..299 CDD:238386 55/242 (23%)
RHOD_ThiF 336..453 CDD:238784 27/185 (15%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45446851
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0476
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR10953
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.840

Return to query results.
Submit another query.