DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Uba1 and Uba5

DIOPT Version :9

Sequence 1:NP_477310.2 Gene:Uba1 / 35998 FlyBaseID:FBgn0023143 Length:1191 Species:Drosophila melanogaster
Sequence 2:NP_572722.2 Gene:Uba5 / 32094 FlyBaseID:FBgn0030305 Length:404 Species:Drosophila melanogaster


Alignment Length:439 Identity:95/439 - (21%)
Similarity:163/439 - (37%) Gaps:127/439 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly   570 LPTEGVEEADAQPVGSRYDSQIAIFGK----KFQEKLADSKWFIVGAGAIG---CELLKNFGMLG 627
            |..:.::...|:.|.|...|::....:    |..|::......|||.|.:|   .::|...|:  
  Fly    35 LARDRIDRMSAEVVDSNPYSRLMALQRMNIVKDYERIRYKAVAIVGVGGVGSVTADMLTRCGI-- 97

  Fly   628 LGTGNGQIFVTDMDLIEKSNLNRQFLFRPHDVQKPKSMTAADAIKRMNPEVNVTAYELRVGAETE 692
                 |::.:.|.|.:|.:|:||.| |.|......|...||..:..:||:|.:..:...:    .
  Fly    98 -----GKLILFDYDKVELANMNRLF-FTPDQAGLSKVAAAAATLSFINPDVEIETHNYNI----T 152

  Fly   693 KVFSEDFF-------GKLDG-----VANALDNVDARIYMDRKCIFNRIPLVETGTL--GTLGNVQ 743
            .|.:.|.|       |::.|     |.:.:||.:||:.::..|....:...|:|..  ...|::|
  Fly   153 TVENFDRFLDTISQGGRIAGQPVDLVLSCVDNFEARMAINAACNERNLNWFESGVSENAVSGHIQ 217

  Fly   744 VIVPFATESYSSSQDPPEKSIPICTLKNFPNAIEHTLQWARDAFEGVFKQS------------AE 796
            .|.|..|..::.:  ||        |....|..|.||:     .|||...|            .:
  Fly   218 FIRPGDTACFACA--PP--------LVVAENIDEKTLK-----REGVCAASLPTTMGITAGFLVQ 267

  Fly   797 NAAQYIADPQFTERIAKLPGIQPLEILDSIKKALIDDKPK-SFAHCVEWARLYWEDQYVNQIKQL 860
            ||.:|:.:  |.| ::...|...|.  |...|..:...|: ...:|:              ::| 
  Fly   268 NALKYLLN--FGE-VSDYLGYNALS--DFFPKMTLKPNPQCDDRNCL--------------VRQ- 312

  Fly   861 LFNFPPDQITSSGQPFWSGPKRCPDPLVFD----VNDPMHLDFIYAAANLRAEVYGIEQV----- 916
                         :.|.:.||    |::.:    ..:|:|      |.|    .:|||.|     
  Fly   313 -------------KEFQARPK----PVLIEEKAVSEEPLH------ATN----EWGIELVAEDAP 350

  Fly   917 RNRETIAE-------LVQKVKVPEFKPRSGVKIETNEAAAAASANNFDD 958
            .:..|.||       |....:.||   :|....|...:||.|...:.:|
  Fly   351 ESNTTPAETPVMGEGLRLAYEAPE---KSSETSEETVSAATADETSLED 396

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Uba1NP_477310.2 Ube1 194..1188 CDD:273603 95/439 (22%)
Ube1_repeat1 199..574 CDD:238768 1/3 (33%)
E1_4HB 447..510 CDD:292809
Ube1_repeat2 606..1144 CDD:238767 88/399 (22%)
Uba5NP_572722.2 ThiF_MoeB_HesA_family 52..297 CDD:238386 64/276 (23%)
ThiF 53..310 CDD:279270 66/302 (22%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45446840
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0476
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR10953
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.840

Return to query results.
Submit another query.