Sequence 1: | NP_477310.2 | Gene: | Uba1 / 35998 | FlyBaseID: | FBgn0023143 | Length: | 1191 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_001101274.1 | Gene: | Mocs3 / 311655 | RGDID: | 1307044 | Length: | 458 | Species: | Rattus norvegicus |
Alignment Length: | 195 | Identity: | 51/195 - (26%) |
---|---|---|---|
Similarity: | 83/195 - (42%) | Gaps: | 30/195 - (15%) |
- Green bases have known domain annotations that are detailed below.
Fly 586 RYDSQIAI--FGKKFQEKLADSKWFIVGAGAIGCELLKNFGMLGLGTGNGQIFVTDMDLIEKSNL 648
Fly 649 NRQFLFRPHDVQKPKSMTAADAIKRMNPEVNVTAYELRVGAETEKVFSEDFFGKLDGVANALDNV 713
Fly 714 DARIYMDRKCIFNRIPLVETGTLGTLGNVQV-----------IVPFATESYSSSQDPPEKSIPIC 767
Fly 768 767 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
Uba1 | NP_477310.2 | Ube1 | 194..1188 | CDD:273603 | 51/195 (26%) |
Ube1_repeat1 | 199..574 | CDD:238768 | |||
E1_4HB | 447..510 | CDD:292809 | |||
Ube1_repeat2 | 606..1144 | CDD:238767 | 44/173 (25%) | ||
Mocs3 | NP_001101274.1 | PRK07411 | 53..458 | CDD:180967 | 51/195 (26%) |
ThiF_MoeB_HesA_family | 60..283 | CDD:238386 | 51/195 (26%) | ||
RHOD_ThiF | 325..458 | CDD:238784 | |||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E1_COG0476 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
2 | 1.810 |