DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Uba1 and Mocs3

DIOPT Version :9

Sequence 1:NP_477310.2 Gene:Uba1 / 35998 FlyBaseID:FBgn0023143 Length:1191 Species:Drosophila melanogaster
Sequence 2:NP_001101274.1 Gene:Mocs3 / 311655 RGDID:1307044 Length:458 Species:Rattus norvegicus


Alignment Length:195 Identity:51/195 - (26%)
Similarity:83/195 - (42%) Gaps:30/195 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly   586 RYDSQIAI--FGKKFQEKLADSKWFIVGAGAIGCELLKNFGMLGLGTGNGQIFVTDMDLIEKSNL 648
            ||..|:.:  .|.:.|.:||.:...:||.|.:||.|.:.....|:    |::.:.|.|::|.|||
  Rat    60 RYSRQLLLPELGVRGQLRLAAASVLVVGCGGLGCPLAQYLAAAGV----GRLGLVDHDVVETSNL 120

  Fly   649 NRQFLFRPHDVQKPKSMTAADAIKRMNPEVNVTAYELRVGAETEKVFSEDFFGKLDGVANALDNV 713
            .||.|.........|:.:||.|::|:|..|....|    .....:.::.|.....|.||:..|||
  Rat   121 ARQVLHGEAQAGHAKAWSAAAALRRLNSAVEYVPY----ARALSEAWALDLVRGYDVVADCSDNV 181

  Fly   714 DARIYMDRKCIFNRIPLVETGTLGTLGNVQV-----------IVPFATESYSSSQDPPEKSIPIC 767
            ..|..::..|:....|||....|...|.:.|           :.|         :.||.:::..|
  Rat   182 PTRYLVNDACVLAGRPLVSASALRFEGQMTVYHYDDGPCYRCVFP---------RPPPAETVTNC 237

  Fly   768  767
              Rat   238  237

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Uba1NP_477310.2 Ube1 194..1188 CDD:273603 51/195 (26%)
Ube1_repeat1 199..574 CDD:238768
E1_4HB 447..510 CDD:292809
Ube1_repeat2 606..1144 CDD:238767 44/173 (25%)
Mocs3NP_001101274.1 PRK07411 53..458 CDD:180967 51/195 (26%)
ThiF_MoeB_HesA_family 60..283 CDD:238386 51/195 (26%)
RHOD_ThiF 325..458 CDD:238784
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0476
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.