DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Uba1 and moc-3

DIOPT Version :9

Sequence 1:NP_477310.2 Gene:Uba1 / 35998 FlyBaseID:FBgn0023143 Length:1191 Species:Drosophila melanogaster
Sequence 2:NP_501359.1 Gene:moc-3 / 177607 WormBaseID:WBGene00018357 Length:402 Species:Caenorhabditis elegans


Alignment Length:217 Identity:61/217 - (28%)
Similarity:89/217 - (41%) Gaps:38/217 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly   560 QWLYFDALECLPTEGVEEADAQPVGSRYDSQIAI--FGKKFQEKLADSKWFIVGAGAIGCELLKN 622
            ||:          .|:.:.||    .||..|:.:  ||...|:.|.:....|||||.:||.:...
 Worm     5 QWV----------AGISKKDA----GRYSRQLLVDDFGVSGQKNLKNLNVLIVGAGGLGCPVATY 55

  Fly   623 FGMLGLGTGNGQIFVTDMDLIEKSNLNRQFLFRPHDVQKPKSMTAADAIKRMNPEVNVTAYELRV 687
            .|..|:||    |.:.|.|.|...||:||..::...|.|.|:...||.||..|.::||..:...:
 Worm    56 LGAAGIGT----IGIVDYDHISLDNLHRQVAYKEDQVGKSKAQALADNIKLQNSDLNVQVHNTSL 116

  Fly   688 GAETEKVFSEDFFGKLDGVANALDNVDARIYMDRKCIFNRIPLVETGTLGTLGNVQVIVPFATES 752
            .:..    :...|...:.|.:..|||..|..::..|:...||||....|...|.:.|        
 Worm   117 DSSN----AMQLFKNYEIVCDCTDNVATRYLINDVCVLLNIPLVSGSALRWDGQLSV-------- 169

  Fly   753 YSSSQDPPEKSIPICTLKNFPN 774
            |....|.|      |....||:
 Worm   170 YHYGSDCP------CYRCLFPS 185

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Uba1NP_477310.2 Ube1 194..1188 CDD:273603 61/217 (28%)
Ube1_repeat1 199..574 CDD:238768 2/13 (15%)
E1_4HB 447..510 CDD:292809
Ube1_repeat2 606..1144 CDD:238767 49/169 (29%)
moc-3NP_501359.1 PRK07878 8..402 CDD:181156 59/204 (29%)
ThiF_MoeB_HesA_family 17..246 CDD:238386 56/191 (29%)
RHOD_ThiF 283..402 CDD:238784
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0476
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.