DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Mmp2 and Mmp23

DIOPT Version :9

Sequence 1:NP_995788.1 Gene:Mmp2 / 35997 FlyBaseID:FBgn0033438 Length:758 Species:Drosophila melanogaster
Sequence 2:NP_446058.1 Gene:Mmp23 / 94339 RGDID:620201 Length:391 Species:Rattus norvegicus


Alignment Length:268 Identity:72/268 - (26%)
Similarity:116/268 - (43%) Gaps:71/268 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly   133 RVRRFALQGP--KWSRTDLTWSMVN--RSMPDASKVERMVQTALDVWANHSKLTFREVYSDQ-AD 192
            |.||:.|...  :|...:||:.:::  |::....:..|.:..|..:|::.|..:||||..:: :|
  Rat    76 RRRRYTLTPARLRWDHFNLTYRILSFPRNLLSPEETRRGLAAAFRMWSDVSPFSFREVAPERPSD 140

  Fly   193 IQILFARRAHGD------GYKFDGPGQVLAHAFYPGEGRGGDAHFDADETWNFDGESDDSHG--- 248
            ::|.|....|.|      .:.||||...|||||:|..   |..|||..|.|.. |.:..|..   
  Rat   141 LKIGFYPVNHTDCLVSALHHCFDGPTGELAHAFFPPH---GGIHFDDSEYWVL-GPTRYSWKKGV 201

  Fly   249 --TNFLNVALHELGHSLGLAHSAIPDAVMFPWYQNNEVAG--NLPDDDRYGIQQLYGTKEK---- 305
              |:.::||.||:||:|||.||....|:|   :.|..:.|  .|..|:.:|:.:|||..::    
  Rat   202 WLTDLVHVAAHEIGHALGLMHSQQDQALM---HLNATLRGWKALSQDELWGLHRLYGCLDRIFVC 263

  Fly   306 -TWG--------------------------PYKPQTTTTTTTTTTMR--------------AMIY 329
             :|.                          |:....|||:.|.|..|              .:::
  Rat   264 TSWARKGFCDVRQRLMKRLCPRSCDFCYEFPFPTVATTTSPTRTKTRFVREGRNMTFHCGQKILH 328

  Fly   330 RADKPAYW 337
            :..| .||
  Rat   329 KKGK-VYW 335

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Mmp2NP_995788.1 Peptidase_M10 143..301 CDD:278824 55/173 (32%)
ZnMc_MMP 143..301 CDD:239805 55/173 (32%)
HX 513..707 CDD:238046
Mmp23NP_446058.1 Peptidase_M10 88..255 CDD:278824 55/173 (32%)
ZnMc_MMP 88..255 CDD:239805 55/173 (32%)
ShKT 256..290 CDD:214586 1/33 (3%)
Ig 314..376 CDD:299845 3/23 (13%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1565
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1075463at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10201
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
44.010

Return to query results.
Submit another query.