DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Mmp2 and MMP23B

DIOPT Version :9

Sequence 1:NP_995788.1 Gene:Mmp2 / 35997 FlyBaseID:FBgn0033438 Length:758 Species:Drosophila melanogaster
Sequence 2:XP_016858104.1 Gene:MMP23B / 8510 HGNCID:7171 Length:526 Species:Homo sapiens


Alignment Length:191 Identity:62/191 - (32%)
Similarity:98/191 - (51%) Gaps:25/191 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly   133 RVRRFALQGP--KWSRTDLTWSMVN--RSMPDASKVERMVQTALDVWANHSKLTFREVYSDQ-AD 192
            |.||:.|...  :|...:||:.:::  |::....:..|.:..|..:|::.|..:||||..:| :|
Human   211 RRRRYTLTPARLRWDHFNLTYRILSFPRNLLSPRETRRALAAAFRMWSDVSPFSFREVAPEQPSD 275

  Fly   193 IQILFARRAHGD------GYKFDGPGQVLAHAFYPGEGRGGDAHFDADETWNFDGESDDSHG--- 248
            ::|.|....|.|      .:.||||...|||||:|..   |..|||..|.|.. |.:..|..   
Human   276 LRIGFYPINHTDCLVSALHHCFDGPTGELAHAFFPPH---GGIHFDDSEYWVL-GPTRYSWKKGV 336

  Fly   249 --TNFLNVALHELGHSLGLAHSAIPDAVMFPWYQNNEVAG--NLPDDDRYGIQQLYGTKEK 305
              |:.::||.||:||:|||.||....|:|   :.|..:.|  .|..|:.:|:.:|||..::
Human   337 WLTDLVHVAAHEIGHALGLMHSQHGRALM---HLNATLRGWKALSQDELWGLHRLYGCLDR 394

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Mmp2NP_995788.1 Peptidase_M10 143..301 CDD:278824 56/173 (32%)
ZnMc_MMP 143..301 CDD:239805 56/173 (32%)
HX 513..707 CDD:238046
MMP23BXP_016858104.1 None
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1565
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1075463at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.