DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Mmp2 and AT1G24140

DIOPT Version :9

Sequence 1:NP_995788.1 Gene:Mmp2 / 35997 FlyBaseID:FBgn0033438 Length:758 Species:Drosophila melanogaster
Sequence 2:NP_173824.2 Gene:AT1G24140 / 839026 AraportID:AT1G24140 Length:384 Species:Arabidopsis thaliana


Alignment Length:297 Identity:92/297 - (30%)
Similarity:137/297 - (46%) Gaps:34/297 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    49 IMYNYLMQFDYLPKSDLETGALRT--EDQLKEAIRSLQSFGNITVTGEIDSATARLIQKPRCGVG 111
            ::..|...|.|:.:::| :|....  :|.||.|:...|....:.|||.:|..|.:.:..||||  
plant    63 MLKQYFQHFGYITETNL-SGNFTDDFDDILKNAVEMYQRNFQLNVTGVLDELTLKHVVIPRCG-- 124

  Fly   112 DRRSADSFSPDNLYH------EIGSNVRVRRF-ALQ-------GPKW--SRTDLTWSMVNRSMPD 160
               :.|..:..:..|      |:....|.:|| |::       .|:|  :|.|||::...|:.. 
plant   125 ---NPDVVNGTSTMHSGRKTFEVSFAGRGQRFHAVKHYSFFPGEPRWPRNRRDLTYAFDPRNAL- 185

  Fly   161 ASKVERMVQTALDVWANHSKLTFREVYS-DQADIQILFARRAHGDGYKFDGPGQVLAHAFYPGEG 224
            ..:|:.:...|...|...:.|||..|.. ..:||.|.|....||||..||||.:.|||||.|..|
plant   186 TEEVKSVFSRAFTRWEEVTPLTFTRVERFSTSDISIGFYSGEHGDGEPFDGPMRTLAHAFSPPTG 250

  Fly   225 RGGDAHFDADETWNFDGESDD-----SHGTNFLNVALHELGHSLGLAHSAIPDAVMFPWYQNNEV 284
            .   .|.|.:|.|...||..|     |...:..:||:||:||.|||.||::..::|:|..:....
plant   251 H---FHLDGEENWIVSGEGGDGFISVSEAVDLESVAVHEIGHLLGLGHSSVEGSIMYPTIRTGRR 312

  Fly   285 AGNLPDDDRYGIQQLYGTKEKTWGPYKPQTTTTTTTT 321
            ..:|..||..|:|.|||......|...|..:|....|
plant   313 KVDLTTDDVEGVQYLYGANPNFNGSRSPPPSTQQRDT 349

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Mmp2NP_995788.1 Peptidase_M10 143..301 CDD:278824 59/165 (36%)
ZnMc_MMP 143..301 CDD:239805 59/165 (36%)
HX 513..707 CDD:238046
AT1G24140NP_173824.2 PG_binding_1 64..116 CDD:279773 15/52 (29%)
Peptidase_M10 167..329 CDD:278824 59/165 (36%)
ZnMc_MMP 167..329 CDD:239805 59/165 (36%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 97 1.000 Domainoid score I2423
eggNOG 1 0.900 - - E1_KOG1565
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1075463at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - mtm995
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10201
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X44
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
76.920

Return to query results.
Submit another query.