DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Mmp2 and VTN

DIOPT Version :9

Sequence 1:NP_995788.1 Gene:Mmp2 / 35997 FlyBaseID:FBgn0033438 Length:758 Species:Drosophila melanogaster
Sequence 2:NP_000629.3 Gene:VTN / 7448 HGNCID:12724 Length:478 Species:Homo sapiens


Alignment Length:229 Identity:60/229 - (26%)
Similarity:86/229 - (37%) Gaps:72/229 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly   474 NGAREPVTPTANTTPRP---TNKPYPTVHRQHHHHNKPRKPKP----DSCM-TYYDAISIIR-GE 529
            |..:.||.......|.|   .:||.....|....|  |.:|:|    :.|. ..:||.:.:: |.
Human   109 NPEQTPVLKPEEEAPAPEVGASKPEGIDSRPETLH--PGRPQPPAEEELCSGKPFDAFTDLKNGS 171

  Fly   530 LFIFRGPYLWRIGTSGLYNGYPTEIRRHWSALPENLTKVDAVYENKQRQIVFFIGREYYVFNSVM 594
            ||.|||.|.:.:....:..|||..||..|                                    
Human   172 LFAFRGQYCYELDEKAVRPGYPKLIRDVW------------------------------------ 200

  Fly   595 LAPGFPKPLASLGLPPTLTHIDASFV-WGHNNRTYMTSGTLYWRIDDYTGQVELDYPRDMSI-WS 657
               |...|            |||:|. .....:||:..|:.|||.:|  |.::.||||::|. :.
Human   201 ---GIEGP------------IDAAFTRINCQGKTYLFKGSQYWRFED--GVLDPDYPRNISDGFD 248

  Fly   658 GVGYNIDAAF----QYLDG--KTYFFKNLGYWEF 685
            |:..|:|||.    ....|  :.||||...|||:
Human   249 GIPDNVDAALALPAHSYSGRERVYFFKGKQYWEY 282

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Mmp2NP_995788.1 Peptidase_M10 143..301 CDD:278824
ZnMc_MMP 143..301 CDD:239805
HX 513..707 CDD:238046 49/187 (26%)
VTNNP_000629.3 SO 20..62 CDD:197571
Cell attachment site 64..66
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 91..158 13/50 (26%)
HX 154..472 CDD:238046 48/182 (26%)
Hemopexin 1 158..202 15/82 (18%)
Hemopexin 2 203..250 18/60 (30%)
Hemopexin 3 251..305 12/32 (38%)
Heparin-binding 362..395
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 364..398
Hemopexin 4 419..472
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1565
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.