DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Mmp2 and mmp13

DIOPT Version :9

Sequence 1:NP_995788.1 Gene:Mmp2 / 35997 FlyBaseID:FBgn0033438 Length:758 Species:Drosophila melanogaster
Sequence 2:NP_001027506.1 Gene:mmp13 / 613098 XenbaseID:XB-GENE-6540414 Length:261 Species:Xenopus tropicalis


Alignment Length:304 Identity:114/304 - (37%)
Similarity:153/304 - (50%) Gaps:57/304 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 ATLLALFAQSMCIQELSLPPEGSHSTAATRSKKAKTAISEDIMYNYLMQF--DYLPKSDLETGAL 70
            |.:.|:.|.| ||..:..|...::.:.:.|                  ||  .||.|..|.|.  
 Frog     4 AIVFAILALS-CIHAMPAPITDNNISPSDR------------------QFAEGYLDKYYLMTA-- 47

  Fly    71 RTEDQLKEAIRSLQSFGNITVTGEIDSATARLIQKPRCGVGDRRSADSFSPDNLYHEIGSNVRVR 135
            ::::...|.|:.:|.|..::|||.:||.|..:::.||||:.|                     |.
 Frog    48 KSKNTFAEKIKEMQKFFGMSVTGRLDSDTMAMMKTPRCGMPD---------------------VA 91

  Fly   136 RFALQGP---KWSRTDLTWSMVNRSMPD--ASKVERMVQTALDVWANHSKLTFREVYSDQADIQI 195
            .|. |.|   :|::|.||:.:||.: ||  .|.|:..::.|..||::.:.|.|..:.|.:|||.|
 Frog    92 EFR-QFPGRQRWTKTQLTYRIVNYT-PDLPRSMVDEAIRLAFKVWSDVTPLKFTRISSRRADIMI 154

  Fly   196 LFARRAHGDGYKFDGPGQVLAHAFYPGEGRGGDAHFDADETWNFDGESDDSHGTNFLNVALHELG 260
            .|..|:|||...||||..||||||.||.|.|||||||.||.|     :..|.|.|...||.||.|
 Frog   155 QFGARSHGDFIPFDGPNGVLAHAFAPGSGIGGDAHFDEDERW-----TSTSAGFNLFLVAAHEFG 214

  Fly   261 HSLGLAHSAIPDAVMFPWYQ-NNEVAGNLPDDDRYGIQQLYGTK 303
            |||||.||..|.|:|||.|: .|.....||.||..|||.:||.|
 Frog   215 HSLGLDHSRDPRALMFPSYRYMNTRNFRLPQDDVNGIQSIYGRK 258

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Mmp2NP_995788.1 Peptidase_M10 143..301 CDD:278824 77/160 (48%)
ZnMc_MMP 143..301 CDD:239805 77/160 (48%)
HX 513..707 CDD:238046
mmp13NP_001027506.1 PG_binding_1 30..80 CDD:396175 18/69 (26%)
Peptidase_M10 101..256 CDD:395334 77/160 (48%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 145 1.000 Domainoid score I4538
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1075463at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10201
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R3504
SonicParanoid 1 1.000 - - X44
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
66.050

Return to query results.
Submit another query.